Recombinant Full Length Ashbya Gossypii Inheritance Of Peroxisomes Protein 2(Inp2) Protein, His-Tagged
Cat.No. : | RFL31683AF |
Product Overview : | Recombinant Full Length Ashbya gossypii Inheritance of peroxisomes protein 2(INP2) Protein (Q755Q0) (1-652aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ashbya gossypii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-652) |
Form : | Lyophilized powder |
AA Sequence : | MYYTPKGLLSGRPGQTMVRESESATGGEGIYAGSPLGNALDWGIDVYTDRSPTVVNDDFE PLDSTMDELFLFPTCRDSYSGTPMGELIRRVFEHGALGGEHFLEEFQYTIITSKGLNVNG MTAPVSSVTGISELNNQNAGPGKTMVHAPTKYGRLVGSRKVLYLRKTVSFLPVALFCVRC FRRLLLVRSKSRKNIIVALLVAIYLALQQENFHSRYVRHATMMNLGKMLNSWSDVEARMH RYHIRLKELTIYRPITLTGGKPPTYPTNNHSLLADLLNMASDMLYYKIKHIVTELLSLAD TENLVHYCGIYDVNMVTLYGYLHTTSDLGTADKINRLQLLKKFSLCILLSITRFDRIVTT RSAVVLKLFPNYKHRYMKETEKLLLLSKALGDVADCLNEVSKVLESYKSQLKYIETSIND QHNNVLPQPVMIESGLERVTVTLNELNEIQNKLFHAESDDETLRKFVQEKLHELCHFWEH TTTKKPTSLLPPQVTSPHRQFHNTSNGFVLNVVKAIETNPAMAPQLTSYEPVTPAGSESC LEQDFLESNFSTESGEHIYSTADEETVAPQYLVDRFDKLSHEELRLRLDEQFKRLTVDTK PPKQHSKKDRLEVLNMNVRDGSNNGYESGPFYSKEESIPVLYELNQLLSNRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | INP2 |
Synonyms | INP2; AFL193W; Inheritance of peroxisomes protein 2 |
UniProt ID | Q755Q0 |
◆ Recombinant Proteins | ||
BIN2-4564G | Recombinant Gossypium hirsutum BIN2 protein, His&HA-tagged | +Inquiry |
RFL6595SF | Recombinant Full Length Salmonella Paratyphi A Sn-Glycerol-3-Phosphate Transport System Permease Protein Ugpe(Ugpe) Protein, His-Tagged | +Inquiry |
ANXA7-172H | Recombinant Human ANXA7 Protein, His-tagged | +Inquiry |
RSPO1-421H | Recombinant Human RSPO1 Protein, His-tagged | +Inquiry |
DUSP26-1975R | Recombinant Rat DUSP26 Protein | +Inquiry |
◆ Native Proteins | ||
CYTC-168E | Native Horse Cytochrome C | +Inquiry |
COL6-116H | Native Human Collagen type VI | +Inquiry |
XOD-22B | Native Bovine XOD Protein | +Inquiry |
Lectin-1777G | Active Native Galanthus Nivalis Lectin Protein, Biotinylated | +Inquiry |
PR-01H | Native HIV1 PR Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACPP-1625MCL | Recombinant Mouse ACPP cell lysate | +Inquiry |
SERHL-1946HCL | Recombinant Human SERHL 293 Cell Lysate | +Inquiry |
GALR2-6028HCL | Recombinant Human GALR2 293 Cell Lysate | +Inquiry |
EPHA6-2126MCL | Recombinant Mouse EPHA6 Overexpression Lysate | +Inquiry |
SERPINE1-2383HCL | Recombinant Human SERPINE1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INP2 Products
Required fields are marked with *
My Review for All INP2 Products
Required fields are marked with *
0
Inquiry Basket