Recombinant Full Length Arginine Abc Transporter Permease Protein Artm(Artm) Protein, His-Tagged
Cat.No. : | RFL22269SF |
Product Overview : | Recombinant Full Length Arginine ABC transporter permease protein ArtM(artM) Protein (P0AE33) (1-222aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella flexneri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-222) |
Form : | Lyophilized powder |
AA Sequence : | MFEYLPELMKGLHTSLTLTVASLIVALILALIFTIILTLKTPVLVWLVRGYITLFTGTPL LVQIFLIYYGPGQFPTLQEYPALWHLLSEPWLCALIALSLNSAAYTTQLFYGAIRAIPEG QWQSCSALGMSKKDTLAILLPYAFKRSLSSYSNEVVLVFKSTSLAYTITLMEVMGYSQLL YGRTYDVMVFGAAGIIYLVVNGLLTLMMRLIERKALAFERRN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | artM |
Synonyms | artM; SF0815; S0857; Arginine ABC transporter permease protein ArtM |
UniProt ID | P0AE33 |
◆ Native Proteins | ||
FGA-55R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
ALB-38R | Native Rhesus monkey Albumin (ALB) Protein | +Inquiry |
LTF-3211B | Native Bovine Lactoferrin Protein | +Inquiry |
Clostripain-02C | Native Clostridium histolyticum Clostripain, Sequencing Grade | +Inquiry |
IgG Fc-07H | Native Human Immunoglobulin G Fc (IgG Fc) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4R-2719HCL | Recombinant Human IL4R cell lysate | +Inquiry |
DHX58-984HCL | Recombinant Human DHX58 cell lysate | +Inquiry |
KCNT2-5013HCL | Recombinant Human KCNT2 293 Cell Lysate | +Inquiry |
KLHDC5-4919HCL | Recombinant Human KLHDC5 293 Cell Lysate | +Inquiry |
TUFM-1864HCL | Recombinant Human TUFM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All artM Products
Required fields are marked with *
My Review for All artM Products
Required fields are marked with *
0
Inquiry Basket