Recombinant Full Length Archaeoglobus Profundus Hdr-Like Menaquinol Oxidoreductase Cytochrome B-Like Subunit(Hmec) Protein, His-Tagged
Cat.No. : | RFL20625AF |
Product Overview : | Recombinant Full Length Archaeoglobus profundus Hdr-like menaquinol oxidoreductase cytochrome b-like subunit(hmeC) Protein (P84628) (1-336aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Archaeoglobus profundus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-336) |
Form : | Lyophilized powder |
AA Sequence : | MSEALYIFYALPYICFAIFVIGTIYRVVDWARSAVPLKIPTTSAQQPSFKFVRRTWIDKI DSPSSKFWAFVRVLFVVFLFRDLFRNTRYYIEMGGKNVDTRWLWLFAILFHYSLLVIVIR HLRFFTNPVPDFVKTLEYLDGVLGVAIVPPLLMTGVIALVALAFLWGRRILLAKERSISI PSDHLILFFMAVILVSGLLMRYIIKADLSYVKMFALSVVTFQPPSPEVLANLHWLFLIHF TFVCITIAYIPFSKVMHFAGVWFSPTRNMPNDNRRKRHVNPWDPNPELPILVREGITVAG VTYKCKKLDWDTYYEMYKDQLDEIAEKNYTLKAEEF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hmeC |
Synonyms | hmeC; Arcpr_1729; Hdr-like menaquinol oxidoreductase cytochrome b-like subunit; Hme subunit C |
UniProt ID | P84628 |
◆ Native Proteins | ||
Lectin-1802L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 488 Labeled | +Inquiry |
TF-31156TH | Native Human TF | +Inquiry |
ALB-21H | Native Human ALB protein | +Inquiry |
Thrombin-12S | Native Atlantic salmon Thrombin | +Inquiry |
sPLA2-60B | Native Bee Venom sPLA2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BGN-1124MCL | Recombinant Mouse BGN cell lysate | +Inquiry |
CDK2AP2-7627HCL | Recombinant Human CDK2AP2 293 Cell Lysate | +Inquiry |
TREX2-802HCL | Recombinant Human TREX2 293 Cell Lysate | +Inquiry |
LYPLA1-4589HCL | Recombinant Human LYPLA1 293 Cell Lysate | +Inquiry |
DYRK1B-6751HCL | Recombinant Human DYRK1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All hmeC Products
Required fields are marked with *
My Review for All hmeC Products
Required fields are marked with *
0
Inquiry Basket