Recombinant Full Length Archaeoglobus Fulgidus Uncharacterized Protein Af_2133 (Af_2133) Protein, His-Tagged
Cat.No. : | RFL18873AF |
Product Overview : | Recombinant Full Length Archaeoglobus fulgidus Uncharacterized protein AF_2133 (AF_2133) Protein (O28147) (1-286aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Archaeoglobus fulgidus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-286) |
Form : | Lyophilized powder |
AA Sequence : | MLIALLLISYQLIKHGYRAADIKNLYTILEGEELRRQKDLSAKLRWGIVDEILWTIIVAN GAILFTAHYVLIGLKILDLIAIFVVMLSGVMLYAPLAFLFLYPVVRAFEKNFPPSNPQFL LSHGLICTVSSLIVYEKLEQLWWDPLLVGFFWIAAGFVSFFTNRRFEVLVFLLLIAPLAL LSVKCPGAILPILLAKSECSLRIQATFLVKLAVLIFASLAAVALVLQVFGYKSLRELSEK RKAAIKQGKYNPLRDPIIWIAWIMLTSLGLLIASFMERGEISPNML |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AF_2133 |
Synonyms | AF_2133; Uncharacterized protein AF_2133 |
UniProt ID | O28147 |
◆ Native Proteins | ||
Brain-013H | Human Brain Lysate, Total Protein | +Inquiry |
LDH2-220H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
Lectin-1789G | Active Native Griffonia Simplicifolia Lectin II Protein, Fluorescein labeled | +Inquiry |
VZV-05 | Native Varicella Zoster Virus (VZV) Glycoprotein Antigen | +Inquiry |
MOG-20 | Native Mouse/Rat MOG (35-55) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPABT-H17728 | Guinea Pig Anti-DOK1 Polyclonal Antibody | +Inquiry |
WDR19-1925HCL | Recombinant Human WDR19 cell lysate | +Inquiry |
PPM1M-493HCL | Recombinant Human PPM1M lysate | +Inquiry |
HA-748HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
EVA1A-263HCL | Recombinant Human EVA1A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AF_2133 Products
Required fields are marked with *
My Review for All AF_2133 Products
Required fields are marked with *
0
Inquiry Basket