Recombinant Full Length Lipopolysaccharide Biosynthesis Protein Wzze(Wzze) Protein, His-Tagged
Cat.No. : | RFL1636EF |
Product Overview : | Recombinant Full Length Lipopolysaccharide biosynthesis protein wzzE(wzzE) Protein (P0AG01) (1-348aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-348) |
Form : | Lyophilized powder |
AA Sequence : | MTQPMPGKPAEDAENELDIRGLFRTLWAGKLWIIGMGLAFALIALAYTFFARQEWSSTAI TDRPTVNMLGGYYSQQQFLRNLDVRSNMASADQPSVMDEAYKEFVMQLASWDTRREFWLQ TDYYKQRMVGNSKADAALLDEMINNIQFIPGDFTRAVNDSVKLIAETAPDANNLLRQYVA FASQRAASHLNDELKGAWAARTIQMKAQVKRQEEVAKAIYDRRMNSIEQALKIAEQHNIS RSATDVPAEELPDSEMFLLGRPMLQARLENLQAVGPAFDLDYDQNRAMLNTLNVGPTLDP RFQTYRYLRTPEEPVKRDSPRRAFLMIMWGIVGGLIGAGVALTRRCSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | wzzE |
Synonyms | wzzE; wzz; Z5296; ECs4718; ECA polysaccharide chain length modulation protein |
UniProt ID | P0AG01 |
◆ Native Proteins | ||
VTN-31737TH | Native Human VTN | +Inquiry |
Fixa-278B | Active Native Bovine Factor Ixa | +Inquiry |
Thrombin-26H | Active Native Human-Thrombin | +Inquiry |
Prothrombin-58M | Native Mouse Prothrombin | +Inquiry |
AMY2-5364P | Native Pig Amylase, Alpha 2B (pancreatic) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPG-7866HCL | Recombinant Human CAPG 293 Cell Lysate | +Inquiry |
ABHD6-9131HCL | Recombinant Human ABHD6 293 Cell Lysate | +Inquiry |
CALCOCO2-7893HCL | Recombinant Human CALCOCO2 293 Cell Lysate | +Inquiry |
KCND3-5068HCL | Recombinant Human KCND3 293 Cell Lysate | +Inquiry |
Cerebellar Peduncles-13H | Human Cerebellar Peduncles Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All wzzE Products
Required fields are marked with *
My Review for All wzzE Products
Required fields are marked with *
0
Inquiry Basket