Recombinant Full Length Archaeoglobus Fulgidus Uncharacterized Protein Af_0098 (Af_0098) Protein, His-Tagged
Cat.No. : | RFL35841AF |
Product Overview : | Recombinant Full Length Archaeoglobus fulgidus Uncharacterized protein AF_0098 (AF_0098) Protein (O30138) (1-107aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Archaeoglobus fulgidus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-107) |
Form : | Lyophilized powder |
AA Sequence : | MDKMKGKKFLVFISFFIILLGILDLIMEFDHRSYIIILVGLASLFASLNISISRLAIAVC IAAAVFIEAIHVSNLHYRVILYAIGSLPLIISVGSYLKGSEKGRGMR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AF_0098 |
Synonyms | AF_0098; Uncharacterized protein AF_0098 |
UniProt ID | O30138 |
◆ Recombinant Proteins | ||
ACOA-1217B | Recombinant Bacillus subtilis ACOA protein, His-tagged | +Inquiry |
BASP1-7256H | Recombinant Human BASP1, His-tagged | +Inquiry |
RFL28111HF | Recombinant Full Length Human Transmembrane Protein 14A(Tmem14A) Protein, His-Tagged | +Inquiry |
CD3E-1055C | Recombinant Canine CD3E Protein, Fc-tagged | +Inquiry |
KIF23-8935Z | Recombinant Zebrafish KIF23 | +Inquiry |
◆ Native Proteins | ||
CRP-5330H | Native Canine CRP protein | +Inquiry |
Lectin-1764C | Active Native Succinylated Canavalia ensiformis Concanavalin A Protein, Biotinylated | +Inquiry |
Acylase-3P | Active Native Porcine Acylase | +Inquiry |
SERPINA3-8349H | Native Human SERPINA3 | +Inquiry |
PYGB-03H | Native Human PYGB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKG1-2850HCL | Recombinant Human PRKG1 293 Cell Lysate | +Inquiry |
LCP2-4794HCL | Recombinant Human LCP2 293 Cell Lysate | +Inquiry |
AKAP5-8939HCL | Recombinant Human AKAP5 293 Cell Lysate | +Inquiry |
MPO-4234HCL | Recombinant Human MPO 293 Cell Lysate | +Inquiry |
CD84-1129CCL | Recombinant Cynomolgus CD84 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AF_0098 Products
Required fields are marked with *
My Review for All AF_0098 Products
Required fields are marked with *
0
Inquiry Basket