Recombinant Full Length Arabis Hirsuta Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL3146AF |
Product Overview : | Recombinant Full Length Arabis hirsuta Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (A4QK14) (15-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabis hirsuta (Hairy rock-cress) (Turritis hirsuta) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (15-473) |
Form : | Lyophilized powder |
AA Sequence : | TLFNGTLALAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHAL LGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGIGAFLLVFKALYFGGVYDTWAPGGG DVRKITNLTLSPSVIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICIFGGIWHILT KPFAWARRALVWSGEAYLSYSLAALSVCGFIACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNG LDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLSTSHFVLG FFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | A4QK14 |
◆ Recombinant Proteins | ||
CLEC5A-11321H | Recombinant Human CLEC5A, His-tagged | +Inquiry |
METTL1-5487M | Recombinant Mouse METTL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KDM3B-2358H | Recombinant Human KDM3B Protein, His-tagged | +Inquiry |
Med25-4017M | Recombinant Mouse Med25 Protein, Myc/DDK-tagged | +Inquiry |
RFL25533AF | Recombinant Full Length Arabidopsis Thaliana Reticulon-Like Protein B16(Rtnlb16) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
T.gondii-39 | Native Toxoplasma gondii Antigen | +Inquiry |
LOC102577615-62P | Native potato LOC102577615 Protein | +Inquiry |
C4A-2H | Native Human Complement C4 | +Inquiry |
APOC3-27333TH | Native Human APOC3 | +Inquiry |
IgG-206M | Native Monkey Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
CES1-7565HCL | Recombinant Human CES1 293 Cell Lysate | +Inquiry |
Duodenum-110H | Human Duodenum Liver Cirrhosis Lysate | +Inquiry |
MANBAL-4522HCL | Recombinant Human MANBAL 293 Cell Lysate | +Inquiry |
TLR2-001RCL | Recombinant Rat TLR2 cell lysate | +Inquiry |
CD276-001MCL | Recombinant Mouse CD276 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket