Recombinant Full Length Arabidopsis Thaliana Upf0496 Protein At5G66675(At5G66675) Protein, His-Tagged
Cat.No. : | RFL17512AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana UPF0496 protein At5g66675(At5g66675) Protein (Q8GW16) (1-412aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-412) |
Form : | Lyophilized powder |
AA Sequence : | MFLGMFSKTMEDKSNSSRNRTNNTPLPQQIRTDMGSLYSADLTAYNSACREDPDLQSFDS SLHQRTNRVINSLASGAQTRSLSFDALIEVSGCLLEMNQEVVRFIIESKEDVWDNKDLTC LVNAYFDSSIKTLDFCNAVDNCVKRARIGQMLLQFALKQFEMESSGSNKSVEPGTNKYAK TLEELNKFKASGDPFDGDFFMLLESVYEQQVMLLEILHKQKRKLDKKLKNIKYWKKISNV VFVTAFVSVLIFSVVAAAVAAPPVVTALAAALAVPIGSIGKWCNHLWKKYETAVKGQKDI VLSMRIGAYVTMKDMDNIRVHVDKLKIEMESMMQKVDFALKEKEEEVAVRLSMHEISKKF DVFTERIEEVGDNATKCSKNITLARTIVLRHILSFPSSSDSGQGNLIEAITL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At5g66675 |
Synonyms | At5g66675; MSN2.6; UPF0496 protein At5g66675 |
UniProt ID | Q8GW16 |
◆ Recombinant Proteins | ||
CX3CL1-926C | Recombinant Canine CX3CL1 Protein (Met1-Gly100), His-tagged | +Inquiry |
CHD7-1216H | Recombinant Human CHD7 Protein | +Inquiry |
HA-379V | Recombinant H3N2 (A/Aichi/2/1968) HA Protein, His-tagged | +Inquiry |
CTTN-9124HFL | Recombinant Full Length Human CTTN, Flag-tagged | +Inquiry |
IFI30-8009M | Recombinant Mouse IFI30 Protein | +Inquiry |
◆ Native Proteins | ||
LDH-35C | Active Native Chicken Lactate dehydrogenase | +Inquiry |
Col4-20M | Native Mouse Collagen IV protein | +Inquiry |
Amyloid P native protein-3441H | Native Human Amyloid P native protein | +Inquiry |
ALP-151P | Active Native Porcine Kidney Alkaline Phosphatase | +Inquiry |
Tryptase-61H | Native Human Mast Cell Tryptase | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL22RA2-739RCL | Recombinant Rat IL22RA2 cell lysate | +Inquiry |
EIF2A-6675HCL | Recombinant Human EIF2A 293 Cell Lysate | +Inquiry |
C2orf48-8076HCL | Recombinant Human C2orf48 293 Cell Lysate | +Inquiry |
KLHDC2-4922HCL | Recombinant Human KLHDC2 293 Cell Lysate | +Inquiry |
BACH1-8531HCL | Recombinant Human BACH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All At5g66675 Products
Required fields are marked with *
My Review for All At5g66675 Products
Required fields are marked with *
0
Inquiry Basket