Recombinant Full Length Arabidopsis Thaliana Upf0392 Protein At1G27200(At1G27200) Protein, His-Tagged
Cat.No. : | RFL24590AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana UPF0392 protein At1g27200(At1g27200) Protein (Q94K98) (1-575aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-575) |
Form : | Lyophilized powder |
AA Sequence : | MTEYENGKKRKVRNKQQVKVQFLSQRYLILCFCCFFVLLFFLSSDRISTLSVRSDSLRPS LRVPTLSVLSSSMDSFHRGRFPPLSVEDRVQFPDHLLLILSHGIGKGEKNLVCVYRGVKE ETLVLPSISSDEFDEFRSIVRCPNAPLNYSSSVDLQFRGDLVKKKMKKQSRRVHNWEKVG YEAVIDGDTVVVFVKGLTRRPHKESDPSYYKCQFEIENSEEKEVTQAIAAAQEVVRCGLP ESLKLNPEMMFRVSVIHIDPRGRTTPALPSVARIYGSDSIEKKEKKSGVKHELCVCTMLW NQAPFLREWIMYHSWLGVERWFIYDNNSDDGIQEEIELLSSENYNVSRHVWPWIKTQEAG FSHCAVRAKEECNWVGFFDVDEFYYFPTHRSQGLPSKNALKSLVSNYTSWDLVGEIRTDC HSYGPSGLTSVPSQGVTVGYTCRQANPERHKSIIRPELLTSSLLNEVHHFQLKEGVGHMS LVESVAVVNHYKYQVWDTFKAKFYRRVATYVVDWQENQNQGSKDRAPGLGTEAIEPPDWK RRFCEVWDTGLKDLVMSNFADQVTGYLPWQRQQQE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At1g27200 |
Synonyms | At1g27200; T7N9.26; Glycosyltransferase family 92 protein At1g27200 |
UniProt ID | Q94K98 |
◆ Recombinant Proteins | ||
CASP18-3481C | Recombinant Chicken CASP18 | +Inquiry |
CHEK2-141H | Active Recombinant Human CHEK2, GST-tagged | +Inquiry |
FAM159B-1403R | Recombinant Rhesus Macaque FAM159B Protein, His (Fc)-Avi-tagged | +Inquiry |
WNT3A-1700H | Recombinant Human WNT3A | +Inquiry |
ARL6IP4-727M | Recombinant Mouse ARL6IP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Y. enterocolitica-30 | Native Yersinia enterocolitica O:8 Antigen | +Inquiry |
FGA-42D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
PROC-64H | Active Native Human Activated Protein C | +Inquiry |
IgA-246H | Native Hamster Immunoglobulin A | +Inquiry |
GPX1-8429H | Native Human GPX1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBM8A-2465HCL | Recombinant Human RBM8A 293 Cell Lysate | +Inquiry |
CGB-341HCL | Recombinant Human CGB cell lysate | +Inquiry |
ENPEP-001HCL | Recombinant Human ENPEP cell lysate | +Inquiry |
PSMD10-2756HCL | Recombinant Human PSMD10 293 Cell Lysate | +Inquiry |
RRP1-2143HCL | Recombinant Human RRP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All At1g27200 Products
Required fields are marked with *
My Review for All At1g27200 Products
Required fields are marked with *
0
Inquiry Basket