Recombinant Full Length Arabidopsis Thaliana Uncharacterized Protein At5G03900, Chloroplastic(At5G03900) Protein, His-Tagged
Cat.No. : | RFL34095AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Uncharacterized protein At5g03900, chloroplastic(At5g03900) Protein (Q8GW20) (63-523aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (63-523) |
Form : | Lyophilized powder |
AA Sequence : | AASLDKVSGAIKPGGLVESDKLPTDVRKRAMDAVDECGRRVTVGDVASRGGLKVTEAQTA LQAIAADTDGFLEVSDEGDVLYVFPRDYRTKLAAKSLRIQIEPFLEKAKGAVDYLARVSF GTALIASIVIVYTSIIALLSSKSEDDNRQRRRGRSYDSGFNFYINPVDLLWYWDPNYYNR RRAREDEGKGMNFIESVFSFVFGDGDPNQGIEEERWQMIGQYITSRGGVVAADELAPYLD VPSSKSAMNDESYILPVLLRFDGQPELDEEGNILYCFPSLQRTASGSSRRKEYVGKWFDW VADMEKFFKEKKWQFSKTSTSERALVIGLGAVNLFGVIVLNTLLNEMSVRPGGFLTFVKN IYPLLQIYAGSFFTIPLIRWFSIKRKNNQIENRNKARLQFARALESPDIALRRKLLSARD MAQKTVIGKDRIVYSTDRDMMEQNYETDEWDRRFKELEKSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At5g03900 |
Synonyms | At5g03900; F8F6_110; MED24.20; Uncharacterized protein At5g03900, chloroplastic |
UniProt ID | Q8GW20 |
◆ Native Proteins | ||
RWV-307S | Native Snake RVV-V ACTIVATOR | +Inquiry |
IgA-250M | Native Monkey Immunoglobulin A | +Inquiry |
T.gondii-39 | Native Toxoplasma gondii Antigen | +Inquiry |
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPBT-32008RH | Rabbit Anti-Human SERPINA6 Polyclonal Antibody | +Inquiry |
CNOT4-7400HCL | Recombinant Human CNOT4 293 Cell Lysate | +Inquiry |
ZBP1-221HCL | Recombinant Human ZBP1 293 Cell Lysate | +Inquiry |
TRAPPC12-1852HCL | Recombinant Human TRAPPC12 cell lysate | +Inquiry |
UFM1-519HCL | Recombinant Human UFM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All At5g03900 Products
Required fields are marked with *
My Review for All At5g03900 Products
Required fields are marked with *
0
Inquiry Basket