Recombinant Full Length Arabidopsis Thaliana Uncharacterized Protein At1G01500(At1G01500) Protein, His-Tagged
Cat.No. : | RFL14861AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Uncharacterized protein At1g01500(At1g01500) Protein (Q8GUH2) (1-327aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-327) |
Form : | Lyophilized powder |
AA Sequence : | MISKDHLHHLDPLGTTKSYHMNTSTVSPPSPASSISLSQSAWLEVRLFYVRIAPCVVENV PDFLTLRHPRRETGASLEVNGVRVPSSQTASLKLRRDRVDRESSEVTYVSTETVRVTGCV DFEVYDNEDMVLCGNLDRIEGAWNNGTVSDPKTGWGMDCYIAMGNGHVSGPSASVFFQPK FGVSSPSVEVYIAGCCGGVPVILTKTIQASPRRKVARHVTLDAIPEDEEVGKEQDIGTIG DELARQSKVQMMESEVDEYDDSDMKMAQRYYPEGMYVDEDGQLSWFNAGVRVGVGIGLGM CLGVGIGVGLLMRSYQATTSNLRRRFL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At1g01500 |
Synonyms | At1g01500; F22L4.17; Uncharacterized protein At1g01500 |
UniProt ID | Q8GUH2 |
◆ Recombinant Proteins | ||
BMI1-2427M | Recombinant Mouse BMI1 Protein | +Inquiry |
EFNA5-130R | Active Recombinant Rhesus EFNA5 protein, hFc-tagged | +Inquiry |
SYNDIG1-5523R | Recombinant Rat SYNDIG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MED25-9697M | Recombinant Mouse MED25 Protein | +Inquiry |
SLC7A11-2957H | Active Recombinant Human SLC7A11 Full Length Transmembrane protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ORM1-110H | Native Human Alpha 1 Acid Glycoprotein (A1AGP) | +Inquiry |
LDL-1538H | Native Human Low-density lipoprotein | +Inquiry |
CP-8075R | Native Rat Serum Ceruloplasmin | +Inquiry |
LOC100514666-45P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
Thrombin-31M | Active Native Mouse Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TOX4-861HCL | Recombinant Human TOX4 293 Cell Lysate | +Inquiry |
NEGR1-2031HCL | Recombinant Human NEGR1 cell lysate | +Inquiry |
WFS1-316HCL | Recombinant Human WFS1 293 Cell Lysate | +Inquiry |
WFDC10A-323HCL | Recombinant Human WFDC10A 293 Cell Lysate | +Inquiry |
PDCL3-3356HCL | Recombinant Human PDCL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All At1g01500 Products
Required fields are marked with *
My Review for All At1g01500 Products
Required fields are marked with *
0
Inquiry Basket