Recombinant Full Length Arabidopsis Thaliana Udp-Glucuronate 4-Epimerase 6(Gae6) Protein, His-Tagged
Cat.No. : | RFL15776AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana UDP-glucuronate 4-epimerase 6(GAE6) Protein (Q9LIS3) (1-460aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-460) |
Form : | Lyophilized powder |
AA Sequence : | MPLSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLIFAINYPPL SDSRAAAAHHLHRRSFLSTGLFSSSSSSSSIGGAAWEKRVRQSSTAKRPHGLSVLVTGAA GFVGSHCSLALRKRGDGVLGFDNFNDYYDPSLKRARQELLEKQQVFIVEGDLNDGPLLRK LFDVVPFTHILHLAAQAGVRYAMKNPQSYIASNIAGFVNLLEVAKAANPQPAIVWASSSS VYGLNTENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRP DMAYFFFTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKR GQAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDF GYKPTTDLAAGLRKFVKWYVGYYGIQPRVKKETSHAEDSA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GAE6 |
Synonyms | GAE6; UGlcAE2; At3g23820; F14O13.1; UDP-glucuronate 4-epimerase 6; UDP-glucuronic acid epimerase 6; AtUGlcAE2 |
UniProt ID | Q9LIS3 |
◆ Recombinant Proteins | ||
Gpc3-120MAF647 | Recombinant Mouse Gpc3 Protein, hFc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
DBT-1007R | Recombinant Rhesus Macaque DBT Protein, His (Fc)-Avi-tagged | +Inquiry |
BIRC2-35HF | Recombinant Full Length Human BIRC2 Protein | +Inquiry |
MBP-01 | Recombinant MBP Protein | +Inquiry |
Tf-5526R | Recombinant Rat Tf protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Troponin C-085B | Native Bovine Troponin C Protein, Sepharose CL 4B attached | +Inquiry |
Collagen Type I-12P | Native Porcine Collagen Type I Protein | +Inquiry |
MG-202H | Native Human Menopausal Gonadotropin | +Inquiry |
IgG-328S | Native Swine Gamma Globulin Fraction | +Inquiry |
F2R-27H | Native Human F2R Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYTSB-7090HCL | Recombinant Human CYTSB 293 Cell Lysate | +Inquiry |
AES-8991HCL | Recombinant Human AES 293 Cell Lysate | +Inquiry |
ARL1-8724HCL | Recombinant Human ARL1 293 Cell Lysate | +Inquiry |
Liver-292R | Rhesus monkey Liver Lysate | +Inquiry |
Wheat-395P | Plant Plant: Wheat Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GAE6 Products
Required fields are marked with *
My Review for All GAE6 Products
Required fields are marked with *
0
Inquiry Basket