Recombinant Full Length Arabidopsis Thaliana Ubiquitin Carboxyl-Terminal Hydrolase 18(Ubp18) Protein, His-Tagged
Cat.No. : | RFL21960AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Ubiquitin carboxyl-terminal hydrolase 18(UBP18) Protein (Q67XW5) (1-631aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-631) |
Form : | Lyophilized powder |
AA Sequence : | MHEVGFPLDLSVFTRLIATLFFLAVGVFYFLKNTAAKYFDIGAAAAGGFDRDFMAVDAED CSVCGNFSTKKCSRCKSVRYCSAECQRSDWSSGHQRNCRDYGITTLTPSAKNGLRFRASP FGDSSASSIALISERGQNKSSLKPREVLFPYEEFVEYFNWDNPELAPCGLMNCGNSCFAN VILQCLSWTRPLVAYLLEKGHKRECMRNDWCFLCEFQTHVERASQSRFPFSPMNIISRLT NIGGTLGYGRQEDAHEFMRYAIDMMQSVCLDEFGGEKIVPPRSQETTLIQYIFGGLLQSQ VQCTVCNHVSDQYENMMDLIVEMHGDAGSLEECLDQFTAEEWLHGDNMYKCDRCSDYVKA CKRLTIRRAPNILTIALKRYQGGRYGKLNKRISFPETLDLNPYMSEGGDGSDVYKLYAVI VHLDMLNASFFGHYICYIKDFCGNWYRIDDSEIESVELEDVLSQRAYMLLYSRIQARSSS SCLRSEVKDEKKTDTLDTESCVKELVESSMVGAIESRSSTHATIEDPVCEQSPSPSPSPS PSPSPSPSPSVLASECCSEVERIDTLDSESNSSIDDSATDHQEDVANGNKDPEVKYQAAD SWSDPTTSTPLVCTKSKPPVRDMDTKMIDAQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UBP18 |
Synonyms | UBP18; At4g31670; F28M20.140; Ubiquitin carboxyl-terminal hydrolase 18; Deubiquitinating enzyme 18; AtUBP18; Ubiquitin thioesterase 18; Ubiquitin-specific-processing protease 18 |
UniProt ID | Q67XW5 |
◆ Recombinant Proteins | ||
THBD-2742D | Recombinant Dog THBD protein, His & GST-tagged | +Inquiry |
DCX-543H | Recombinant Human DCX protein(Ala45-Val150), GST-tagged | +Inquiry |
TNFRSF4-3246HAF555 | Recombinant Human TNFRSF4 Protein, Fc/His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
RFL7761RF | Recombinant Full Length Rat C-X-C Chemokine Receptor Type 1(Cxcr1) Protein, His-Tagged | +Inquiry |
Ahcy-01M | Recombinant Mouse Ahcy Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
NEFH-181B | Native Bovine NEFH Protein | +Inquiry |
TroponinCIT-33HFL | Native Full Length Human Cardiac Troponin C-I-T Complex | +Inquiry |
Prothrombin-92M | Native Mouse Prothrombin | +Inquiry |
Protein S-90H | Native Human Protein S | +Inquiry |
Cry1Ab-36B | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTD-8395HCL | Recombinant Human BTD 293 Cell Lysate | +Inquiry |
BCKDK-8491HCL | Recombinant Human BCKDK 293 Cell Lysate | +Inquiry |
Eye-537E | Equine Eye Lysate, Total Protein | +Inquiry |
RHBDL3-2359HCL | Recombinant Human RHBDL3 293 Cell Lysate | +Inquiry |
RABEPK-525HCL | Recombinant Human RABEPK lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBP18 Products
Required fields are marked with *
My Review for All UBP18 Products
Required fields are marked with *
0
Inquiry Basket