Recombinant Full Length Arabidopsis Thaliana Sterol 14-Demethylase(Cyp51G1) Protein, His-Tagged
Cat.No. : | RFL3163AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Sterol 14-demethylase(CYP51G1) Protein (Q9SAA9) (1-488aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-488) |
Form : | Lyophilized powder |
AA Sequence : | MELDSENKLLKTGLVIVATLVIAKLIFSFFTSDSKKKRLPPTLKAWPPLVGSLIKFLKGP IIMLREEYPKLGSVFTVNLVHKKITFLIGPEVSAHFFKASESDLSQQEVYQFNVPTFGPG VVFDVDYSVRQEQFRFFTEALRVNKLKGYVDMMVTEAEDYFSKWGESGEVDIKVELERLI ILTASRCLLGREVRDQLFDDVSALFHDLDNGMLPISVLFPYLPIPAHRRRDRAREKLSEI FAKIIGSRKRSGKTENDMLQCFIESKYKDGRQTTESEVTGLLIAALFAGQHTSSITSTWT GAYLMRYKEYFSAALDEQKNLIAKHGDKIDHDILSEMDVLYRCIKEALRLHPPLIMLMRA SHSDFSVTARDGKTYDIPKGHIVATSPAFANRLPHIFKDPDTYDPERFSPGREEDKAAGA FSYIAFGGGRHGCLGEPFAYLQIKAIWSHLLRNFELELVSPFPEIDWNAMVVGVKGNVMV RYKRRQLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYP51G1 |
Synonyms | CYP51G1; CYP51A2; EMB1738; At1g11680; F25C20.17; Sterol 14-demethylase; Cytochrome P450 51A2; Cytochrome P450 51G1; AtCYP51; Obtusifoliol 14-demethylase; Protein EMBRYO DEFECTIVE 1738 |
UniProt ID | Q9SAA9 |
◆ Recombinant Proteins | ||
LASS5-5001M | Recombinant Mouse LASS5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Prss2-909M | Active Recombinant Mouse Prss2 protein, His-tagged | +Inquiry |
ICAM3-2268H | Recombinant Human ICAM3 Protein, His-tagged | +Inquiry |
THRS-0527B | Recombinant Bacillus subtilis THRS protein, His-tagged | +Inquiry |
METTL3-166H | Recombinant Human METTL3 and METTL14 Protein, His/GST/His-tagged | +Inquiry |
◆ Native Proteins | ||
GC-29857TH | Native Human GC | +Inquiry |
Thrombin-27B | Active Native Bovine alpha-Thrombin | +Inquiry |
GALM-40P | Active Native Porcine Mutarotase | +Inquiry |
APOB-8037H | Native Human Plasma APOB | +Inquiry |
Ubiquitin-001 | Biotinylated Ubiquitin | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGGY-6230HCL | Recombinant Human FGGY 293 Cell Lysate | +Inquiry |
C12orf29-8324HCL | Recombinant Human C12orf29 293 Cell Lysate | +Inquiry |
FGF5-6239HCL | Recombinant Human FGF5 293 Cell Lysate | +Inquiry |
TMEM175-1105HCL | Recombinant Human TMEM175 cell lysate | +Inquiry |
CCR3-7694HCL | Recombinant Human CCR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CYP51G1 Products
Required fields are marked with *
My Review for All CYP51G1 Products
Required fields are marked with *
0
Inquiry Basket