Recombinant Full Length Arabidopsis Thaliana Squalene Monooxygenase 1,1(Sqp1,1) Protein, His-Tagged
Cat.No. : | RFL36942AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Squalene monooxygenase 1,1(SQP1,1) Protein (O65404) (1-516aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-516) |
Form : | Lyophilized powder |
AA Sequence : | MAFTNVCLWTLLAFMLTWTVFYVTNRGKKATQLADAVVEEREDGATDVIIVGAGVGGSAL AYALAKDGRRVHVIERDLREPERIMGEFMQPGGRLMLSKLGLEDCLEGIDAQKATGMTVY KDGKEAVASFPVDNNNFPFDPSARSFHNGRFVQRLRQKASSLPNVRLEEGTVKSLIEEKG VIKGVTYKNSAGEETTALAPLTVVCDGCYSNLRRSLNDNNAEVLSYQVGFISKNCQLEEP EKLKLIMSKPSFTMLYQISSTDVRCVFEVLPNNIPSISNGEMATFVKNTIAPQVPLKLRK IFLKGIDEGEHIKAMPTKKMTATLSEKKGVILLGDAFNMRHPAIASGMMVLLSDILILRR LLQPLSNLGNAQKISQVIKSFYDIRKPMSATVNTLGNAFSQVLVASTDEAKEAMRQGCYD YLSSGGFRTSGMMALLGGMNPRPISLIYHLCAITLSSIGHLLSPFPSPLRIWHSLRLFGL AMKMLVPHLKAEGVSQMLFPVNAAAYSKSYMAATAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SQE5 |
Synonyms | SQE5; SQP1,1; At5g24150; K12G2.2; Squalene epoxidase 5; AtSQE5; Squalene monooxygenase 1,1; SE 1,1 |
UniProt ID | O65404 |
◆ Recombinant Proteins | ||
SLIT1-8445M | Recombinant Mouse SLIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SSP-RS06710-0301S | Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 SSP_RS06710 protein, His-tagged | +Inquiry |
ZFP750-19062M | Recombinant Mouse ZFP750 Protein | +Inquiry |
LRRC8D-3481R | Recombinant Rat LRRC8D Protein | +Inquiry |
PADI3-6600C | Recombinant Chicken PADI3 | +Inquiry |
◆ Native Proteins | ||
Chitin-001C | Native Crawfish Chitin | +Inquiry |
Lectin-1865W | Active Native Succinylated Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
TTR-706H | Native Human Transthyretin | +Inquiry |
CAPN1-8448H | Active Native Human CAPN1 | +Inquiry |
Thrombin-12S | Native Atlantic salmon Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
G3BP1-6085HCL | Recombinant Human G3BP1 293 Cell Lysate | +Inquiry |
Breast-57H | Human Breast Membrane Lysate | +Inquiry |
DGKB-6959HCL | Recombinant Human DGKB 293 Cell Lysate | +Inquiry |
GPRC5D-749HCL | Recombinant Human GPRC5D cell lysate | +Inquiry |
TXNDC15-625HCL | Recombinant Human TXNDC15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SQE5 Products
Required fields are marked with *
My Review for All SQE5 Products
Required fields are marked with *
0
Inquiry Basket