Recombinant Full Length Arabidopsis Thaliana Ring-H2 Finger Protein Atl5(Atl5) Protein, His-Tagged
Cat.No. : | RFL33867AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana RING-H2 finger protein ATL5(ATL5) Protein (Q9LZJ6) (1-257aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-257) |
Form : | Lyophilized powder |
AA Sequence : | MGNLFDSSKTLWGNMNHGSSRYSLNGKIMLASVIILFVAVILILCFHSYARWLFRRQNRR IRRRISAHLRSLAAARDPTQSSSSLSPLDPTVLEKIPIFVYSVKTHESPLEECSVCLSEF EEDDEGRVLPKCGHVFHVDCIDTWFRSRSSCPLCRAPVQPAQPVTEPEPVAAVFPSVKPI EDTEAGSSSSSDESESSTPSSSSGSPVRFPMEACEREPIDLVGIIVEIPREFQDSNSDLP ADNGSNRRASLKRLWII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATL5 |
Synonyms | ATL5; At3g62690; F26K9_120; RING-H2 finger protein ATL5; RING-type E3 ubiquitin transferase ATL5 |
UniProt ID | Q9LZJ6 |
◆ Recombinant Proteins | ||
DNASE1L3-4417H | Recombinant Human DNASE1L3 protein | +Inquiry |
ARPC3-5195H | Recombinant Human ARPC3 protein, GST-tagged | +Inquiry |
CRISPLD1-3913M | Recombinant Mouse CRISPLD1 Protein | +Inquiry |
RFL11850BF | Recombinant Full Length Bacillus Subtilis Sporulation Membrane Protein Ytri(Ytri) Protein, His-Tagged | +Inquiry |
CDCA4-1497M | Recombinant Mouse CDCA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Fixa-278B | Active Native Bovine Factor Ixa | +Inquiry |
CKM-5305H | Native Human creatine kinase, muscle | +Inquiry |
Type II Collagen-01C | Native Chicken Type II Collagen | +Inquiry |
FGA-39B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
IgG-010E | Native Horse Whole Molecule IgG, Biotin Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNE3-5064HCL | Recombinant Human KCNE3 293 Cell Lysate | +Inquiry |
VTCN1-1636MCL | Recombinant Mouse VTCN1 cell lysate | +Inquiry |
U-138-061HCL | Human U-138 MG Whole Cell Lysate | +Inquiry |
IL36B-5236HCL | Recombinant Human IL1F8 293 Cell Lysate | +Inquiry |
GCFC2-8082HCL | Recombinant Human C2orf3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATL5 Products
Required fields are marked with *
My Review for All ATL5 Products
Required fields are marked with *
0
Inquiry Basket