Recombinant Full Length Arabidopsis Thaliana Ring-H2 Finger Protein Atl34(Atl34) Protein, His-Tagged
Cat.No. : | RFL34913AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana RING-H2 finger protein ATL34(ATL34) Protein (Q9C7I1) (27-327aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (27-327) |
Form : | Lyophilized powder |
AA Sequence : | QHQPRTTAPPYIAQRPNQVPAVIIAMLMFTLLFSMLACCVCYKYTNTSPHGTSSDTEEGG HGEVAFTRRTSRGLGKDVINSFPSFLYSQVKGLKIGKGGVECAICLNEFEDEETLRLMPP CSHAFHASCIDVWLSSRSTCPVCRASLPPKPGSDQNSLYPFIRPHDNQDMDLENVTARRS VLESPDVRLLDRLSWSNNTGANTPPRSRSTGLSNWRITELLFPRSHSTGHSLVPRVENLD RFTLQLPEEVRRQLSHMKTLPQARSSREGYRSGSVGSERRGKGKEKEFGEGSFDRLKAEM V |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATL34 |
Synonyms | ATL34; At1g35330; T9I1.10; RING-H2 finger protein ATL34; RING-type E3 ubiquitin transferase ATL34 |
UniProt ID | Q9C7I1 |
◆ Native Proteins | ||
Lectin-1806L | Active Native Lycopersicon Esculentum Lectin Protein | +Inquiry |
LDH-227H | Active Native Human Lactate Dehydrogenase Total | +Inquiry |
ALB-54C | Native Cyno monkey Albumin | +Inquiry |
A2m-8030M | Native Mouse A2m | +Inquiry |
Lectin-1737W | Active Native Wheat Germ Agglutinin Protein, Peroxidase conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
PECAM1-3049HCL | Recombinant Human PECAM1 cell lysate | +Inquiry |
KEL-4990HCL | Recombinant Human KEL 293 Cell Lysate | +Inquiry |
CD209-2986HCL | Recombinant Human CD209 cell lysate | +Inquiry |
GP140-1506HCL | Recombinant HIV GP140 cell lysate | +Inquiry |
TPPP3-343HCL | Recombinant Human TPPP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ATL34 Products
Required fields are marked with *
My Review for All ATL34 Products
Required fields are marked with *
0
Inquiry Basket