Recombinant Full Length Arabidopsis Thaliana Ring-H2 Finger Protein Atl11(Atl11) Protein, His-Tagged
Cat.No. : | RFL29346AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana RING-H2 finger protein ATL11(ATL11) Protein (Q84W40) (37-404aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (37-404) |
Form : | Lyophilized powder |
AA Sequence : | GFKFVAGQATHGGSDVSGDSSRFDPTMAILMIVLVSVFFFLGFFSVYIRRCLERVMGMDY GNPNDAGNWLATNRQQARGLDASIIETFPTFQYSTVKTLRIGKEALECSVCLNEFEDDET LRLIPKCCHVFHPGCIDAWLRSHTTCPLCRADLIPVPGESIVSIQIPGLVNDPPGSDPNG DRIRSLGSPDARLIESVALTCNQSMPRRSMSTGWNLAGMFTNSDRTGQHSENLDRFTLRL PQDIHNKLVNPNLSKVHVALPQVMSSTRGYRTGSLGSERNYFYYERFDQDGRLDRRPFSI TPPYRTSSINHMSPGGSGGDKVRASSPKSLLLAMRSPFDRLFLGKNNNVGENSSDHLRSC DATPSNTV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATL11 |
Synonyms | ATL11; At1g72200; T9N14.11; RING-H2 finger protein ATL11; RING-type E3 ubiquitin transferase ATL11 |
UniProt ID | Q84W40 |
◆ Recombinant Proteins | ||
CRYAB-01H | Recombinant Human CRYAB Protein, Myc/DDK-tagged | +Inquiry |
SLC25A26-8280M | Recombinant Mouse SLC25A26 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL9483EF | Recombinant Full Length Upf0073 Inner Membrane Protein Yqfa(Yqfa) Protein, His-Tagged | +Inquiry |
Aicda-1248M | Recombinant Mouse Aicda protein, His-tagged | +Inquiry |
UGT78D1-2642A | Recombinant Arabidopsis Thaliana UGT78D1 Protein (1-453 aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
Bone Marrow-007H | Human Bone Marrow Lysate, Total Protein | +Inquiry |
ABL1-618H | Native Human C-abl Oncogene 1, Receptor Tyrosine Kinase | +Inquiry |
SUMO Protease-01 | Native purified SUMO Protease, N-His-tagged | +Inquiry |
ctxB-01V | Native Vibrio cholerae ctxB Protein | +Inquiry |
GGT1-8130H | Native Human Liver Gamma-Glutamyltransferase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARMC6-8701HCL | Recombinant Human ARMC6 293 Cell Lysate | +Inquiry |
NUDCD3-3657HCL | Recombinant Human NUDCD3 293 Cell Lysate | +Inquiry |
USP12-473HCL | Recombinant Human USP12 293 Cell Lysate | +Inquiry |
DAD1-215HCL | Recombinant Human DAD1 lysate | +Inquiry |
SSR2-1698HCL | Recombinant Human SSR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATL11 Products
Required fields are marked with *
My Review for All ATL11 Products
Required fields are marked with *
0
Inquiry Basket