Recombinant Full Length Arabidopsis Thaliana Ring-H2 Finger Protein Atl10(Atl10) Protein, His-Tagged
Cat.No. : | RFL3670AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana RING-H2 finger protein ATL10(ATL10) Protein (P0C034) (1-251aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-251) |
Form : | Lyophilized powder |
AA Sequence : | MSANELPSSAQAFQEQFLGGFVSRKLLLHNPFDHNTQRAFAVAPSPLITHENNLSGNVMM LLSILICGIICCLGLHYIIRCALRRSTRFMISEPVPSLSSTRGSSNKGIKKKALRMFPVV SYSPEMNLPGLDEECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQQHLTCPKCRNCL VETCQKILGDFSQADSVTAEPTEIVIVTIVPLEPTEIVIVTIAPLEPTEIVIVMIAPLEP EGRVNTIREIS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATL10 |
Synonyms | ATL10; At1g49220; F27J15.37; RING-H2 finger protein ATL10; RING-type E3 ubiquitin transferase ATL10 |
UniProt ID | P0C034 |
◆ Recombinant Proteins | ||
WDR77-5018R | Recombinant Rhesus Macaque WDR77 Protein, His (Fc)-Avi-tagged | +Inquiry |
HGF-790H | Recombinant Human HGF protein, His-tagged | +Inquiry |
Atp1b2-663M | Recombinant Mouse Atp1b2 Protein, MYC/DDK-tagged | +Inquiry |
CLDN6-2060HF | Recombinant Full Length Human CLDN6 Protein, GST-tagged | +Inquiry |
NME6-1456H | Recombinant Human NME6 protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
Bone Marrow-007H | Human Bone Marrow Lysate, Total Protein | +Inquiry |
CGA-8162H | Native Human Pregnancy Chorionic Gonadotropin | +Inquiry |
C3d-48HB | Native Human Complement C3d Protein, Biotinylated | +Inquiry |
LDH3-124H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
Lectin-1853U | Active Native Ulex Europaeus Agglutinin I Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
FEZ1-6260HCL | Recombinant Human FEZ1 293 Cell Lysate | +Inquiry |
SERPINB7-1584HCL | Recombinant Human SERPINB7 cell lysate | +Inquiry |
CD3D & CD3E-1714HCL | Recombinant Human CD3D & CD3E cell lysate | +Inquiry |
SPINK1-1511HCL | Recombinant Human SPINK1 293 Cell Lysate | +Inquiry |
G6PC-6082HCL | Recombinant Human G6PC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ATL10 Products
Required fields are marked with *
My Review for All ATL10 Products
Required fields are marked with *
0
Inquiry Basket