Recombinant Full Length Arabidopsis Thaliana Reticulon-Like Protein B18(Rtnlb18) Protein, His-Tagged
Cat.No. : | RFL31304AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Reticulon-like protein B18(RTNLB18) Protein (Q8LDS3) (1-457aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-457) |
Form : | Lyophilized powder |
AA Sequence : | MDSTTTPPSLRSNTRSALRLARNNKTLVKSHIPSLDLVLLSPKNNNGTPYPSPVSLSSPS SPVTLREILLLSPSPLRKSRTRLSNRFDMEAAEAAVTARRSKTKGGQNGLLASPSPRNFR RSRLRSEAMVDTKENTEPIVVVTDEKKQNQRKQKKLGRSKKEKHSSVPLLASPSPSSDQP QDVCQGDLERIRENISDLIMWRDVAKSTLWFGFGCICFLSTCFAAKGFNFSVFSAISYLG LLFLGVSFLSNTLRQRVTEEARRELKLSEDDVLRIARRMLPITNLAISKTSELFSGEPAM TLKVAPFVLMGAEYGYLITLWRLCAFGFFLSFTIPKLYSCYASQLNQKVECAQRRFVEAW GVCTHKKFVAGSAVTAFWNLTSLKTRFIAVFIIVVVIRYRRQNLQLDSEDEEEKKQQEKT HPEQQKSPEDKSTSPRSAEEEQALVLVAETKAPKKLY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RTNLB18 |
Synonyms | RTNLB18; At4g28430; F20O9.110; Reticulon-like protein B18; AtRTNLB18 |
UniProt ID | Q8LDS3 |
◆ Recombinant Proteins | ||
IL7R-5701HF | Recombinant Full Length Human IL7R Protein, GST-tagged | +Inquiry |
TNFRSF13C-536H | Recombinant Human TNFRSF13C Protein (Ser7-Ala71), C-mFc-tagged | +Inquiry |
RFL29748PF | Recombinant Full Length Prochlorococcus Marinus Photosystem Q(B) Protein Protein, His-Tagged | +Inquiry |
TNFAIP8-4864R | Recombinant Rhesus monkey TNFAIP8 Protein, His-tagged | +Inquiry |
HCRTR1-7523M | Recombinant Mouse HCRTR1 Protein | +Inquiry |
◆ Native Proteins | ||
calc1-8308S | Native Salmon calc1 | +Inquiry |
Endoproteinase Lys-C-85L | Native Lysobacter enzymogenes Endoproteinase Lys-C | +Inquiry |
SNCA-27345TH | Native Human SNCA | +Inquiry |
Lectin-1828P | Active Native Pisum Sativum Agglutinin Protein, Biotinylated | +Inquiry |
Neuraminidase-011C | Active Native Clostridium perfringens Choloylglycine Hydrolase | +Inquiry |
◆ Cell & Tissue Lysates | ||
STX11-1381HCL | Recombinant Human STX11 293 Cell Lysate | +Inquiry |
HS578T-004WCY | Human Breast Carcinoma HS578T Whole Cell Lysate | +Inquiry |
L3MBTL4-965HCL | Recombinant Human L3MBTL4 cell lysate | +Inquiry |
ACSS1-19HCL | Recombinant Human ACSS1 cell lysate | +Inquiry |
NLRP5-3797HCL | Recombinant Human NLRP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All RTNLB18 Products
Required fields are marked with *
My Review for All RTNLB18 Products
Required fields are marked with *
0
Inquiry Basket