Recombinant Full Length Arabidopsis Thaliana Putative Udp-Glucuronate:Xylan Alpha-Glucuronosyltransferase 4(Gux4) Protein, His-Tagged
Cat.No. : | RFL29112AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 4(GUX4) Protein (Q9FZ37) (1-557aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-557) |
Form : | Lyophilized powder |
AA Sequence : | MGTKTHNSRGKIFMIYLILVSLSLLGLILPFKPLFRITSPSSTLRIDLPSPQVNKNPKWL RLIRNYLPEKRIQVGFLNIDEKERESYEARGPLVLKNIHVPLDHIPKNVTWKSLYPEWIN EEASTCPEIPLPQPEGSDANVDVIVARVPCDGWSANKGLRDVFRLQVNLAAANLAVQSGL RTVNQAVYVVFIGSCGPMHEIFPCDERVMRVEDYWVYKPYLPRLKQKLLMPVGSCQIAPS FAQFGQEAWRPKHEDNLASKAVTALPRRLRVAYVTVLHSSEAYVCGAIALAQSIRQSGSH KDMILLHDHTITNKSLIGLSAAGWNLRLIDRIRSPFSQKDSYNEWNYSKLRVWQVTDYDK LVFIDADFIILKKLDHLFYYPQLSASGNDKVLFNSGIMVLEPSACMFKDLMEKSFKIESY NGGDQGFLNEIFVWWHRLSKRVNTMKYFDEKNHRRHDLPENVEGLHYLGLKPWVCYRDYD CNWDISERRVFASDSVHEKWWKVYDKMSEQLKGYCGLNKNMEKRIEKWRRIAKNNSLPDR HWEIEVRDPRKTNLLVQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GUX4 |
Synonyms | GUX4; PGSIP4; At1g54940; F14C21.47; T24C10.6; Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 4; UDP-GlcA:xylan glucuronyltransferase 4; Glycogenin-like protein 4; Plant glycogenin-like starch initiation protein 4; Protein GLUCURONIC ACID SUB |
UniProt ID | Q9FZ37 |
◆ Recombinant Proteins | ||
S-528S | Recombinant SARS-CoV-2 (2019-nCoV) Spike RBD(N370S) Protein, His-tagged | +Inquiry |
SDS-2555H | Recombinant Human SDS, His-tagged | +Inquiry |
CPPED1-3856M | Recombinant Mouse CPPED1 Protein | +Inquiry |
GUCY2F-0406H | Recombinant Human GUCY2F protein, His-tagged | +Inquiry |
HMOX1-1597H | Recombinant Human Heme Oxygenase (decycling) 1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
LH-838H | Active Native Human Luteinizing Hormone | +Inquiry |
PLG -38C | Native Chicken plasmin | +Inquiry |
CTSL1-1859H | Native Human Cathepsin L1 | +Inquiry |
FGG -57R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
IBVV0400-231I | Native Influenza (B/Victoria/504/00) IBVV0400 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF329-94HCL | Recombinant Human ZNF329 293 Cell Lysate | +Inquiry |
NDUFB4-3905HCL | Recombinant Human NDUFB4 293 Cell Lysate | +Inquiry |
NOXA1-3749HCL | Recombinant Human NOXA1 293 Cell Lysate | +Inquiry |
PLEKHA7-3116HCL | Recombinant Human PLEKHA7 293 Cell Lysate | +Inquiry |
CSRNP1-7236HCL | Recombinant Human CSRNP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GUX4 Products
Required fields are marked with *
My Review for All GUX4 Products
Required fields are marked with *
0
Inquiry Basket