Recombinant Full Length Arabidopsis Thaliana Putative Receptor-Like Protein Kinase At2G30940(At2G30940) Protein, His-Tagged
Cat.No. : | RFL35019AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Putative receptor-like protein kinase At2g30940(At2g30940) Protein (Q3EBR4) (1-453aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-453) |
Form : | Lyophilized powder |
AA Sequence : | MQEWLEILLIHTLIDSSSLSPQRLRVMNRIISSQGSDLIKQKLSQHTSFFGIKLWILITA SASIAFLLVLIISVLLCFIFHRRRCSQEPFRLRSKLCLPLSHIPLTNKQQIPYNRCGDDI ESQRISQVGWSSARLSYYTRSFSSTGSFGSFNVFTFMEIKNVTDSFADDNVITKGDSSTV YRGILMGTVTVAVKRFLPSNSRYEDKDFITKAEMIANVRHKNVVRLLGYCIEGDERVLVY EYAEKGDLHEWLHGSAGRNRPLTWRKRMKIIQGVAKGLAYIHEDIEPKITHQDIRPSKIL LDYQWNPKILDVGFIGHSDIPTLIPSPGNMDEKIDVYSFGNMIMELVSGRVSVDQSSPHV RVYLVDWIKEMVANHMIVDVLDPSLPEFPTIKELKRIVLISLRCVDPELKERPKMGDVIH MLQPHDLLLNNNAIQKAQKITRSHEVSAISIRQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At2g30940 |
Synonyms | At2g30940; F7F1.15; Putative receptor-like protein kinase At2g30940 |
UniProt ID | Q3EBR4 |
◆ Native Proteins | ||
FN1-700H | Native Human Fibronectin 1 | +Inquiry |
Lectin-1779G | Active Native Griffonia Simplicifolia Lectin I Protein, Biotinylated | +Inquiry |
Actin-21R | Native Rabbit Actin Protein | +Inquiry |
C8-57H | Native Human Complement C8 | +Inquiry |
Thrombin-31M | Active Native Mouse Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
BLVRA-8441HCL | Recombinant Human BLVRA 293 Cell Lysate | +Inquiry |
RET-570HCL | Recombinant Human RET cell lysate | +Inquiry |
SNRPD1-617HCL | Recombinant Human SNRPD1 lysate | +Inquiry |
AMOT-8878HCL | Recombinant Human AMOT 293 Cell Lysate | +Inquiry |
CFC1-339HCL | Recombinant Human CFC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All At2g30940 Products
Required fields are marked with *
My Review for All At2g30940 Products
Required fields are marked with *
0
Inquiry Basket