Recombinant Full Length Arabidopsis Thaliana Putative Inactive Cadmium/Zinc-Transporting Atpase Hma3(Hma3) Protein, His-Tagged
Cat.No. : | RFL16441AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Putative inactive cadmium/zinc-transporting ATPase HMA3(HMA3) Protein (P0CW77) (1-542aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-542) |
Form : | Lyophilized powder |
AA Sequence : | MAEGEESKKMNLQTSYFDVVGICCSSEVSIVGNVLRQVDGVKEFSVIVPSRTVIVVHDTF LISPLQIVKALNQARLEASVRPYGETSLKSQWPSPFAIVSGVLLVLSFFKYFYSPLEWLA IVAVVAGVFPILAKAVASVTRFRLDINALTLIAVIATLCMQDFTEAATIVFLFSVADWLE SSAAHKASIVMSSLMSLAPRKAVIADTGLEVDVDEVGINTVVSVKAGESIPIDGVVVDGS CDVDEKTLTGESFPVSKQRESTVMAATINLNGYIKVKTTALARDCVVAKMTKLVEEAQKS QTKTQRFIDKCSRYYTPAVVVSAACFAVIPVLLKVQDLSHWFHLALVVLVSGCPCGLILS TPVATFCALTKAATSGFLIKTGDCLETLAKIKIVAFDKTGTITKAEFMVSDFRSLSPSIN LHKLLYWVSSIECKSSHPMAAALIDYARSVSVEPKPDIVENFQNFPGEGVYGRIDGQDIY IGNKRIAQRAGCLTDNVPDIEATMKRGKTIGYIYMGAKLTGSFNLLDGCRYGVAQALKEL KS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HMA3 |
Synonyms | HMA3; At4g30120; F6G3.150; Putative inactive cadmium/zinc-transporting ATPase HMA3; Putative inactive cadmium/zinc-transporting ATPase 4; Putative inactive protein HEAVY METAL ATPASE 3 |
UniProt ID | P0CW77 |
◆ Recombinant Proteins | ||
GP9-205HF | Recombinant Full Length Human GP9 Protein | +Inquiry |
GRB7-2341R | Recombinant Rat GRB7 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXW2-1959R | Recombinant Rat FBXW2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDC42EP2-764R | Recombinant Rhesus monkey CDC42EP2 Protein, His-tagged | +Inquiry |
RFL17505GF | Recombinant Full Length Guillardia Theta Photosystem I Reaction Center Subunit Iii(Psaf) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Hemocyanin-31S | Native Shrimp hemocyanin Protein, a substitute for KLH, animal free, SMCC Activated | +Inquiry |
ACHE-8345H | Native Human ACHE | +Inquiry |
B. abortus-23 | Native Brucella abortus Antigen | +Inquiry |
ACTC1-885B | Native Bovine ACTC1 Protein, Pyrene labeled | +Inquiry |
ALPL-5324H | Active Native Human Alkaline Phosphatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Prostate-404C | Cynomolgus monkey Prostate Lysate | +Inquiry |
C9orf169-7938HCL | Recombinant Human C9orf169 293 Cell Lysate | +Inquiry |
TSPAN8-1064HCL | Recombinant Human TSPAN8 cell lysate | +Inquiry |
P2RY1-1267HCL | Recombinant Human P2RY1 cell lysate | +Inquiry |
Rye-708P | Rye Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMA3 Products
Required fields are marked with *
My Review for All HMA3 Products
Required fields are marked with *
0
Inquiry Basket