Recombinant Full Length Arabidopsis Thaliana Protochlorophyllide-Dependent Translocon Component 52, Chloroplastic(Ptc52) Protein, His-Tagged
Cat.No. : | RFL18452AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Protochlorophyllide-dependent translocon component 52, chloroplastic(PTC52) Protein (Q8W496) (56-559aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (56-559) |
Form : | Lyophilized powder |
AA Sequence : | SSAATSTNSPPEPEALFEPGSDKFDWYANWYPVMPICDLDKKVPHGKKVMGIDLVVWWDR NEKQWKVMDDTCPHRLAPLSDGRIDQWGRLQCVYHGWCFNGSGDCKLIPQAPPDGPPVHT FKQACVAVYPSTVQHEIIWFWPNSDPKYKNIIETNKPPYIPELEDPSFTKLMGNRDIPYG YDVLVENLMDPAHVPYAHYGLMRFPKPKGKYIICISNSCFNPFTNLQILLAEKIDREGGK PLEINVKKLDNKGFFSKQEWGYSNFIAPCVYRSSTDPLPEQEHEYPAPAASDKAALSKRR LSLIFICIPVSPGRSRLIWTFPRNFGVFIDKIVPRWVFHIGQNTILDSDLHLLHVEERKI LERGPENWQKACFIPTKSDANVVTFRRWFNKYSEARVDWRGKFDPFLLPPTPPREQLFDR YWSHVENCSSCKKAHKYLNALEVILQIASVAMIGVMAVLKQTTMSNVARIAVLVAAVLSF AASKWLSHFIYKTFHYHDYNHAVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PTC52 |
Synonyms | PTC52; ACD1-like; TIC55-IV; At4g25650; L73G19.30; Protochlorophyllide-dependent translocon component 52, chloroplastic; ACD1-like protein; Protein TIC 55-IV; Translocon at the inner envelope membrane of chloroplasts 55-IV |
UniProt ID | Q8W496 |
◆ Recombinant Proteins | ||
UGT3A2-9895M | Recombinant Mouse UGT3A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBE2K-0044H | Recombinant Human UBE2K Protein (A2-N200), Tag Free | +Inquiry |
HK3-316H | Recombinant Human HK3 Protein, MYC/DDK-tagged | +Inquiry |
SLC3A2-1057H | Recombinant Human SLC3A2 protein(Arg206-Ala630), His-tagged, Biotinylated | +Inquiry |
SRC-533H | Active Recombinant Human SRC protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
VZV-04 | Native Varicella Zoster Virus (VZV) Antigen | +Inquiry |
REN-245H | Active Native Human Renin | +Inquiry |
LDH2-8340H | Native Human LDH2 | +Inquiry |
Actin-889P | Native Porcine Actin Protein | +Inquiry |
FN1-2708H | Native Human FN1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNK-306HCL | Recombinant Full Length Human CCNK cell lysate | +Inquiry |
PPP2R5D-2914HCL | Recombinant Human PPP2R5D 293 Cell Lysate | +Inquiry |
SPRR3-1493HCL | Recombinant Human SPRR3 293 Cell Lysate | +Inquiry |
LTV1-4608HCL | Recombinant Human LTV1 293 Cell Lysate | +Inquiry |
RBM10-2482HCL | Recombinant Human RBM10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PTC52 Products
Required fields are marked with *
My Review for All PTC52 Products
Required fields are marked with *
0
Inquiry Basket