Recombinant Full Length Arabidopsis Thaliana Protein Phloem Protein 2-Like A10(Pp2A10) Protein, His-Tagged
Cat.No. : | RFL23734AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Protein PHLOEM PROTEIN 2-LIKE A10(PP2A10) Protein (Q9SY57) (1-414aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-414) |
Form : | Lyophilized powder |
AA Sequence : | MDLLRLREKGIFLSQRRRKWLIFMAISGVSGYGAYKVYHLPSVARKRKRLFKLFGAIVSV AELISDSAETLSMVSRDVKDFLNSDSDEIPNSLKQIAKITTSNEFTDSLSRVSQAVTIGA FRGYKSESSIGDSGIEKSSDSSVVDRVIDKVFSEAGTGFVSVVVGSFAKNLVLGFYSGKV ESGVKCEGSDSSETPRWVTLLGDDKCRELLADCIERFTSTAIGVYLDKTMDINTYDQIFE GLTNPKHQDSVKDVLVSVCNGALETIVRTSHDVFTSSRSKNVIEEIEDDDFKSNGSARSK MVSESGDGVKSNGWTEAIATTLAVPSNRRFMFDVTGRVTLETTRSIIAFIMVKTFQGFRK SINVVHEEVTDRGRQAVEYVGAKSSVIITVCLALYLHIISGCVRNSPIGVSQHF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PP2A10 |
Synonyms | PP2A10; At1g10150; F14N23.3; Protein PHLOEM PROTEIN 2-LIKE A10; AtPP2-A10 |
UniProt ID | Q9SY57 |
◆ Recombinant Proteins | ||
RFL28944RF | Recombinant Full Length Rat Leucine-Rich Repeat And Fibronectin Type Iii Domain-Containing Protein 1(Lrfn1) Protein, His-Tagged | +Inquiry |
PALM-29957TH | Recombinant Human PALM, His-tagged | +Inquiry |
MATN3-5388M | Recombinant Mouse MATN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD244-4777H | Recombinant Human CD244 protein, GST-tagged | +Inquiry |
HPV31-L1-05H | Recombinant HPV31 L1 Protein | +Inquiry |
◆ Native Proteins | ||
Pancreas-002H | Human Pancreas Lysate, Total Protein | +Inquiry |
F2-5286R | Native Rat Coagulation Factor II | +Inquiry |
PLAU -15H | Native Human HMW urokinase, HRP conjugate | +Inquiry |
BCHE-26067TH | Native Human BCHE | +Inquiry |
IgA-248A | Native Alpaca Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAMP2-2536HCL | Recombinant Human RAMP2 293 Cell Lysate | +Inquiry |
AP1M2-86HCL | Recombinant Human AP1M2 cell lysate | +Inquiry |
JOSD2-5098HCL | Recombinant Human JOSD2 293 Cell Lysate | +Inquiry |
SLC22A6-1793HCL | Recombinant Human SLC22A6 293 Cell Lysate | +Inquiry |
NUFIP2-3637HCL | Recombinant Human NUFIP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PP2A10 Products
Required fields are marked with *
My Review for All PP2A10 Products
Required fields are marked with *
0
Inquiry Basket