Recombinant Full Length Arabidopsis Thaliana Protein Gamete Expressed 1(Gex1) Protein, His-Tagged
Cat.No. : | RFL23113AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Protein GAMETE EXPRESSED 1(GEX1) Protein (Q681K7) (25-593aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-593) |
Form : | Lyophilized powder |
AA Sequence : | HSWGWFSSSSSSAEDPYSSSFSRSRKSNPDFSMEVFSDQKAVQVLENKLVGLTSCWQNAY SYLLAGCKETIATEEKRKRFAWYLSDCFIKDSGRPAFPTCKDESVMMSCLKKLDDHEHKI YLDFLLETNTICQQLQSNAFKNEIERLVNELKNTAQYTEDKLDILESKSDALIQTSSMIH DSLGSLDVRVQNVASVTNTLETSVSGLSQQTVEISQEQKNIAESQLALRDGQVKMKETLK DGMDMFLDAYTNIQEGVDKLKSDTEQIEVEISVLGNNLSTKMIDLQSTTDDIGTKTRSSL DKQQKLLDGQTVALDGIQFLTRFQSEALQESRNTLQRLKEFSQEQQEDLAKRQEKLQEVH DHLFENSKSMLEAQVAFEAKQANMFVALDKLFALHNAMLLESRVIKAFVIYFLSIFVIYM FTSTKQTYIIRPRLYIGLCVTLALEVASLRYVNDTERQAWMINLIRSLFALLASAQLLHA ALSYRDYEVLNHQILLRLVDKVNDMQSKKELSYDEDTESEVDWTSWVDTDLTDDDDNLAD PDYKIPLLIKDNPVTTSSLTRRLYNFRPR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GEX1 |
Synonyms | GEX1; At5g55490; MTE17.20; Protein GAMETE EXPRESSED 1 |
UniProt ID | Q681K7 |
◆ Recombinant Proteins | ||
EIF2AK2-298H | Recombinant Human EIF2AK2, GST-tagged, Active | +Inquiry |
MLKL-6980HF | Recombinant Full Length Human MLKL Protein, GST-tagged | +Inquiry |
FBXO36-4673HF | Recombinant Full Length Human FBXO36 Protein, GST-tagged | +Inquiry |
TNP2-9502M | Recombinant Mouse TNP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CORO6-11481H | Recombinant Human CORO6, His-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type III-06H | Native Human Collagen Type III | +Inquiry |
Lipoprotein-246 | Native Human Oxidized LDL (Ox-LDL) | +Inquiry |
IgE-507H | Native Human IgE protein | +Inquiry |
CTSD-27858TH | Native Human CTSD | +Inquiry |
Lectin-1720P | Native Peanut Lectin, Biotin conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD34-3047HCL | Recombinant Human CD34 cell lysate | +Inquiry |
ZNF362-87HCL | Recombinant Human ZNF362 293 Cell Lysate | +Inquiry |
HRAS-556HCL | Recombinant Human HRAS cell lysate | +Inquiry |
TBX18-655HCL | Recombinant Human TBX18 lysate | +Inquiry |
PCDHGA1-3389HCL | Recombinant Human PCDHGA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GEX1 Products
Required fields are marked with *
My Review for All GEX1 Products
Required fields are marked with *
0
Inquiry Basket