Recombinant Full Length Human FBXO36 Protein, GST-tagged
Cat.No. : | FBXO36-4673HF |
Product Overview : | Human FBXO36 full-length ORF ( AAH33935.1, 1 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 188 amino acids |
Description : | Members of the F-box protein family, such as FBXO36, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 48.5 kDa |
AA Sequence : | MASWLPETLFETVGQGPPPSKDYYQLLVTRSQVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILDYVINFCKGKFDFLERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDTGWRQLFFTNKLQLQRQLRKRKQKYGNLREKQP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FBXO36 F-box protein 36 [ Homo sapiens ] |
Official Symbol | FBXO36 |
Synonyms | FBXO36; F-box protein 36; F box only protein 36; F-box only protein 36; Fbx36; FLJ37592; FLJ41090; |
Gene ID | 130888 |
mRNA Refseq | NM_174899 |
Protein Refseq | NP_777559 |
MIM | 609105 |
UniProt ID | Q8NEA4 |
◆ Recombinant Proteins | ||
FBXO36-5747M | Recombinant Mouse FBXO36 Protein | +Inquiry |
FBXO36-3163M | Recombinant Mouse FBXO36 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXO36-3941H | Recombinant Human FBXO36 Protein, GST-tagged | +Inquiry |
FBXO36-5062H | Recombinant Human FBXO36 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Fbxo36-2969M | Recombinant Mouse Fbxo36 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXO36-605HCL | Recombinant Human FBXO36 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FBXO36 Products
Required fields are marked with *
My Review for All FBXO36 Products
Required fields are marked with *
0
Inquiry Basket