Recombinant Full Length Arabidopsis Thaliana Probable S-Acyltransferase At3G48760(At3G48760) Protein, His-Tagged
Cat.No. : | RFL2471AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable S-acyltransferase At3g48760(At3g48760) Protein (Q9M306) (1-476aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-476) |
Form : | Lyophilized powder |
AA Sequence : | MLDLQPSDRRHGAPSSSGGVSGGDELIRTYKGWKGNNVFFLGGRLVFGPDARSILITVFL ITAPVIVFCIFVGRKFIDDFPHHRGVSVLAVAVGLILLDLVFLLLTSARDPGIIPRNLYP PEPESNEGNGEPRLAHTPQSRLPRTKDMIVNGITVKIKYCDTCMLYRPPRASHCSICNNC VEKFDHHCPWLGQCIGLRNYRFYFMFVLCSTLLCIYVHVFCWIYVKRIMDSENINIWKSF LKTPASIALIIYTFICVWFVGGLTCFHLYLMSTNQSTYENFRYRYDRHENPFNKGIVGNF MEVFCTNVAVSQNSFREKVSKEPAIPPRTVNGGMSSPSLQKVSNDIEMGRKPVWHETVEE ELGDIEKDMEAGVASRDLSRMLPPEESEGRGIMHSRESSRGRGIMHSRESSRGRRGGSWE LSSRVNEDLRTRDESVSRVGEDSSESSDNDASRDLHVEIYDAVTSRGRTGTGIGRL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PAT05 |
Synonyms | PAT05; At3g48760; T21J18.30; Probable protein S-acyltransferase 5; Probable palmitoyltransferase At3g48760; Zinc finger DHHC domain-containing protein At3g48760 |
UniProt ID | Q9M306 |
◆ Recombinant Proteins | ||
RFL34561SF | Recombinant Full Length Staphylococcus Aureus Na(+)/H(+) Antiporter Subunit G1(Mnhg1) Protein, His-Tagged | +Inquiry |
Bsg-722M | Recombinant Mouse Bsg Protein, MYC/DDK-tagged | +Inquiry |
AQP12B-3596H | Recombinant Human AQP12B, His-tagged | +Inquiry |
BMP4-261H | Recombinant Human BMP4 protein | +Inquiry |
PRMT3-119H | Recombinant Human PRMT3 protein, T7/His-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-314H | Native Human Albumin Fluorescein | +Inquiry |
Lectin-1780G | Active Native Griffonia Simplicifolia Lectin I Protein, Fluorescein labeled | +Inquiry |
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
HP-127H | Native Human Hemoglobin protein | +Inquiry |
Lectin-1716U | Native Ulex europaeus Lectin, Biotin conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
STOML1-1392HCL | Recombinant Human STOML1 293 Cell Lysate | +Inquiry |
TINAGL1-1061HCL | Recombinant Human TINAGL1 293 Cell Lysate | +Inquiry |
ACE2-3100HCL | Recombinant Human ACE2 cell lysate | +Inquiry |
Skin-671H | Hamster Skin Lysate, Total Protein | +Inquiry |
NUP155-3632HCL | Recombinant Human NUP155 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAT05 Products
Required fields are marked with *
My Review for All PAT05 Products
Required fields are marked with *
0
Inquiry Basket