Recombinant Full Length Arabidopsis Thaliana Probable Receptor-Like Serine/Threonine-Protein Kinase At4G34500(At4G34500) Protein, His-Tagged
Cat.No. : | RFL25211AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable receptor-like serine/threonine-protein kinase At4g34500(At4g34500) Protein (Q6NKZ9) (1-437aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-437) |
Form : | Lyophilized powder |
AA Sequence : | MSDSGGGSHKSSTTKPSVFGLNLYLVIAICSVFILLISLLIFLFVCLNRVSRARRMRVKH SSGSIPLVSKEISEIKTVGKFINSDDSKGKIGNEVVVVVSATSKEATSGFDTLSVASSGD VGTSEAMGWGKWYSLKDLEIATRGFSDDNMIGEGGYGVVYRADFSDGSVAAVKNLLNNKG QAEKEFKVEVEAIGKVRHKNLVGLMGYCADSAQSQRMLVYEYIDNGNLEQWLHGDVGPVS PLTWDIRMKIAIGTAKGLAYLHEGLEPKVVHRDVKSSNILLDKKWNAKVSDFGLAKLLGS ETSYVTTRVMGTFGYVSPEYASTGMLNECSDVYSFGVLLMEIITGRSPVDYSRPPGEMNL VDWFKGMVASRRGEEVIDPKIKTSPPPRALKRALLVCLRCIDLDSSKRPKMGQIIHMLEA EDFPFRPEHRSNQERSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At4g34500 |
Synonyms | At4g34500; T4L20.80; Probable receptor-like serine/threonine-protein kinase At4g34500 |
UniProt ID | Q6NKZ9 |
◆ Recombinant Proteins | ||
ACE-514P | Recombinant Pig ACE protein, His & GST-tagged | +Inquiry |
CDKL4-1533M | Recombinant Mouse CDKL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM222-9365M | Recombinant Mouse TMEM222 Protein, His (Fc)-Avi-tagged | +Inquiry |
Spike-301V | Recombinant COVID-19 Spike RBD (V341I) protein, His-tagged | +Inquiry |
SEC13-14819M | Recombinant Mouse SEC13 Protein | +Inquiry |
◆ Native Proteins | ||
slo-01S | Active Native Streptococcus pyogenes Streptolysin O protein | +Inquiry |
CT-34 | Native Chlamydia trachomatis Antigen | +Inquiry |
LCN2-384H | Native Human LCN2 | +Inquiry |
SULF2-02F | Active Native Flavobacterium heparinum 2-O-Sulfatase | +Inquiry |
Col4-20M | Native Mouse Collagen IV protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATF1-8632HCL | Recombinant Human ATF1 293 Cell Lysate | +Inquiry |
GPX8-5761HCL | Recombinant Human GPX8 293 Cell Lysate | +Inquiry |
Brain-839P | Pig Brain Membrane Lysate, Total Protein | +Inquiry |
SNUPN-1606HCL | Recombinant Human SNUPN 293 Cell Lysate | +Inquiry |
CNR2-7394HCL | Recombinant Human CNR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All At4g34500 Products
Required fields are marked with *
My Review for All At4g34500 Products
Required fields are marked with *
0
Inquiry Basket