Recombinant Full Length Arabidopsis Thaliana Probable Mannan Synthase 3(Csla3) Protein, His-Tagged
Cat.No. : | RFL22308AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable mannan synthase 3(CSLA3) Protein (Q9LQC9) (1-556aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-556) |
Form : | Lyophilized powder |
AA Sequence : | MSPFLKFFLFLYDYLSPSSFFLVQRNTLGASLDTTDGVVRSGIIGEIIYIWKQTRIFVFI PILKCLVTICLVMSLLLFIERVYMSIVVVFVKLLRRTPEKVHKWEPINDDDLELANTNYP MVLIQIPMYNEKEVCQLSIGAACRLSWPLDRMIVQVLDDSTDPASKELVNAECDKWARKG INIMSEIRDNRIGYKAGALKAGMMHNYVKQCEFVAIFDADFQPDPDFLERTIPFLIHNHE ISLVQCRWKFVNANECLMTRMQEMSLNYHFVAEQESGSSIHAFFGFNGTAGVWRIAALNE AGGWKDRTTVEDMDLAVRACLHGWKFVYVHDVEVKNELPSTFKAYRFQQHRWSCGPANLW RKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPTTVLFPELQVPKWA TVYFPTTITILNAIATPRSLHLLVFWILFENVMSMHRTKATFIGLLEAGRVNEWVVTEKL GDTLKSKLIGKATTKLYTRFGQRLNWRELVVGLYIFFCGCYDFAYGGSYFYVYLFLQSCA FFVAGVGYIGTFVPTV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CSLA3 |
Synonyms | CSLA3; At1g23480; F28C11.11; F5O8.4; Probable glucomannan 4-beta-mannosyltransferase 3; Cellulose synthase-like protein A3; AtCslA3; Glucomannan synthase; Mannan synthase 3 |
UniProt ID | Q9LQC9 |
◆ Native Proteins | ||
PLD-18A | Active Native Arachis hypogaea (peanut) Phospholipase D, Type II | +Inquiry |
alpha Thrombin native protein-3287H | Native Human alpha Thrombin | +Inquiry |
TG-22P | Native Porcine Thyroglobulin (TG) Protein | +Inquiry |
GSN-874P | Active Native Porcine GSN Protein | +Inquiry |
Cp-048R | Native Rat Ceruloplasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
C20orf111-8126HCL | Recombinant Human C20orf111 293 Cell Lysate | +Inquiry |
AGR3-8971HCL | Recombinant Human AGR3 293 Cell Lysate | +Inquiry |
MET-001HCL | Recombinant Human MET cell lysate | +Inquiry |
MDA-MB-361-170H | MDA-MB-361 Whole Cell Lysate | +Inquiry |
GATA1-689HCL | Recombinant Human GATA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSLA3 Products
Required fields are marked with *
My Review for All CSLA3 Products
Required fields are marked with *
0
Inquiry Basket