Recombinant Full Length Arabidopsis Thaliana Probable Glycerol-3-Phosphate Acyltransferase 3(Gpat3) Protein, His-Tagged
Cat.No. : | RFL9510AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable glycerol-3-phosphate acyltransferase 3(GPAT3) Protein (Q9SYJ2) (1-520aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-520) |
Form : | Lyophilized powder |
AA Sequence : | MSAKISIFQALVFLFYRFILRRYRNSKPKYQNGPSSLLQSDLSRHTLIFNVEGALLKSDS LFPYFMLVAFEAGGVIRSFLLFILYPLISLMSHEMGVKVMVMVSFFGIKKEGFRAGRAVL PKYFLEDVGLEMFEVLKRGGKKIGVSDDLPQVMIEGFLRDYLEIDVVVGREMKVVGGYYL GIMEDKTKHDLVFDELVRKERLNTGRVIGITSFNTSLHRYLFSQFCQEIYFVKKSDKRSW QTLPRSQYPKPLIFHDGRLAIKPTLMNTLVLFMWGPFAAAAAAARLFVSLCIPYSLSIPI LAFSGCRLTVTNDYVSSQKQKPSQRKGCLFVCNHRTLLDPLYVAFALRKKNIKTVTYSLS RVSEILAPIKTVRLTRDRVSDGQAMEKLLTEGDLVVCPEGTTCREPYLLRFSPLFTEVSD VIVPVAVTVHVTFFYGTTASGLKALDPLFFLLDPYPTYTIQFLDPVSGATCQDPDGKLKF EVANNVQSDIGKALDFECTSLTRKDKYLILAGNNGVVKKN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPAT3 |
Synonyms | GPAT3; At4g01950; T7B11.21; Probable glycerol-3-phosphate acyltransferase 3; AtGPAT3 |
UniProt ID | Q9SYJ2 |
◆ Recombinant Proteins | ||
SLC23A2-6810HF | Recombinant Full Length Human SLC23A2 Protein, GST-tagged | +Inquiry |
CHRNA9-781H | Recombinant Human CHRNA9 Protein, His&GST-tagged | +Inquiry |
RFL23721HF | Recombinant Full Length Human Putative Olfactory Receptor 7A2(Or7A2P) Protein, His-Tagged | +Inquiry |
MFRP-4070H | Recombinant Human MFRP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
WASF2-1839H | Recombinant Human WASF2 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
F13-53H | Active Native Human Coagulation Factor XIII, Alexa Fluor 700 Conjugated | +Inquiry |
TF-102H | Native Human Transferrin (HOLO) | +Inquiry |
POPG-42 | Active Native Pyruvate oxidase | +Inquiry |
Actin-3084R | Active Native Rabbit Actin Protein | +Inquiry |
Tropomyosin-894R | Native Rabbit Tropomyosin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM120B-1010HCL | Recombinant Human TMEM120B 293 Cell Lysate | +Inquiry |
CD200-2707HCL | Recombinant Human CD200 cell lysate | +Inquiry |
EXOSC2-6503HCL | Recombinant Human EXOSC2 293 Cell Lysate | +Inquiry |
NDUFS6-1179HCL | Recombinant Human NDUFS6 cell lysate | +Inquiry |
BMPR1A-2466MCL | Recombinant Mouse BMPR1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPAT3 Products
Required fields are marked with *
My Review for All GPAT3 Products
Required fields are marked with *
0
Inquiry Basket