Recombinant Human WASF2 protein, GST-tagged

• Cat.No.: WASF2-1839H
• Product Overview: Recombinant Human WASF2 (1 a.a. - 498 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. The published map location (PMID:10381382) has been changed based on recent genomic sequence comparisons, which indicate that the expressed gene is located on chromosome 1, and a pseudogene may be located on chromosome X.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 80.7 kDa
• AA Sequence: MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANTFASRVSSLAERVDRL QVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDTPPPLNNLTPYRDDGKEALKFY TDPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYP PTLVYQNGSIGCVENVDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHP PPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADY PTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPLSDTTKPKSSLPAVSDARSDLLSAIRQGFQL RRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSEDDSSEFDEDDWSD
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 1-498 a.a.

Gene Information

• Gene Name: WASF2 WAS protein family, member 2 [ Homo sapiens ]
• Official Symbol: WASF2
• Synonyms: IMD2; SCAR2; WASF4; WAVE2; dJ393P12.2; wiskott-Aldrich syndrome protein family member 2; WASP family Verprolin-homologous protein 2; WASP family protein member 2; WASP family protein member 4; protein WAVE-2; putative Wiskott-Aldrich syndrome protein family member 4; suppressor of cyclic-AMP receptor (WASP-family); verprolin homology domain-containing protein 2
• Gene ID: 10163
• mRNA Refseq: NM_006990
• Protein Refseq: NP_008921
• MIM: 605875
• UniProt ID: Q9Y6W5
• Chromosome Location: 1p36.11
• Pathway: Adherens junction, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Choline metabolism in cancer, conserved biosystem
• Function: actin binding; protein binding; protein complex binding