Recombinant Full Length Arabidopsis Thaliana Probable Calcium-Activated Outward-Rectifying Potassium Channel 2(Kco2) Protein, His-Tagged
Cat.No. : | RFL8439AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable calcium-activated outward-rectifying potassium channel 2(KCO2) Protein (Q9FL25) (1-443aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-443) |
Form : | Lyophilized powder |
AA Sequence : | MANDGNGDNNDDPLRQYLMNPRINPPPPSLLTLPENNDVTIPMPITPLELKNRLIFGSFV RSRKESSLPIDALSQNPSTSSSATTSFSDSTDLLLPLTEPNKPVRKSKPTINFHRSKTAP AMAAINNISHPNDPKTDQQSDSKTIVNQAVALLVVYLSLGVLIYWLNRDSYNVKQTHPVV DALYFCIVTMCTIGYGDITPDSVVTKLFSIFFVLVGFGFMDILLSGMVTYVLDLQENYML ETARNESLNLNDRDKVRSYIIDVKKGRMRIRLKVGLALGVVVLCLGFGVLIMHFVEKIGW LDSFYFSVMSVTTVGYGDRAFNTLAGRLLAAMWLLVSTLAVARAILFLAESRVDKRNRER AKKVLGESMSISQFLDADIDCNGCVSKAEFVIYKLKKMDKITEKDINPIGFQFDKLDRTN SGRITLLDLLESSTKDLPTATSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TPK2 |
Synonyms | TPK2; KCO2; At5g46370; MPL12.17; Two-pore potassium channel 2; AtTPK2; Calcium-activated outward-rectifying potassium channel 2; AtKCO2 |
UniProt ID | Q9FL25 |
◆ Recombinant Proteins | ||
CSL3-3799S | Recombinant Salmo keta CSL3 protein, His-tagged | +Inquiry |
TMEM215-4622R | Recombinant Rhesus Macaque TMEM215 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cdkn2b-1253M | Recombinant Mouse Cdkn2b protein, His & T7-tagged | +Inquiry |
IMPA1-5557H | Recombinant Human IMPA1 protein, His-tagged | +Inquiry |
NUDT3-2946R | Recombinant Rhesus Macaque NUDT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen-121B | Native Bovine Type II Collagen, FITC-tagged | +Inquiry |
FGA-55R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
IgG-016M | Native Mouse Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
MOG-20 | Native Mouse/Rat MOG (35-55) Protein | +Inquiry |
L. pneumophila-26 | Native Legionella pneumophila Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
Epididymis-8H | Human Adult Epididymis Membrane Lysate | +Inquiry |
USP3-462HCL | Recombinant Human USP3 293 Cell Lysate | +Inquiry |
GABRQ-6055HCL | Recombinant Human GABRQ 293 Cell Lysate | +Inquiry |
ZADH2-225HCL | Recombinant Human ZADH2 293 Cell Lysate | +Inquiry |
CPBTT-30930RH | Rabbit Anti-Human AKT Polyclonal Antibody | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TPK2 Products
Required fields are marked with *
My Review for All TPK2 Products
Required fields are marked with *
0
Inquiry Basket