Recombinant Full Length Arabidopsis Thaliana Probable Beta-1,3-Galactosyltransferase 20(B3Galt20) Protein, His-Tagged
Cat.No. : | RFL4534AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 20(B3GALT20) Protein (A7XDQ9) (1-684aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-684) |
Form : | Lyophilized powder |
AA Sequence : | MKRVKSESFRGVYSSRRFKLSHFLLAIAGFYLVFLAFKFPHFIEMVAMLSGDTGLDGALS DTSLDVSLSGSLRNDMLNRKLEDEDHQSGPSTTQKVSPEEKINGSKQIQPLLFRYGRISG EVMRRRNRTIHMSPFERMADEAWILGSKAWEDVDKFEVDKINESASIFEGKVESCPSQIS MNGDDLNKANRIMLLPCGLAAGSSITILGTPQYAHKESVPQRSRLTRSYGMVLVSQFMVE LQGLKTGDGEYPPKILHLNPRIKGDWNHRPVIEHNTCYRMQWGVAQRCDGTPSKKDADVL VDGFRRCEKWTQNDIIDMVDSKESKTTSWFKRFIGREQKPEVTWSFPFAEGKVFVLTLRA GIDGFHINVGGRHVSSFPYRPGFTIEDATGLAVTGDVDIHSIHATSLSTSHPSFSPQKAI EFSSEWKAPPLPGTPFRLFMGVLSATNHFSERMAVRKTWMQHPSIKSSDVVARFFVALNP RKEVNAMLKKEAEYFGDIVILPFMDRYELVVLKTIAICEFGVQNVTAPYIMKCDDDTFIR VESILKQIDGVSPEKSLYMGNLNLRHRPLRTGKWTVTWEEWPEAVYPPYANGPGYIISSN IAKYIVSQNSRHKLRLFKMEDVSMGLWVEQFNASMQPVEYSHSWKFCQYGCTLNYYTAHY QSPSQMMCLWDNLLKGRPQCCNFR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GALT2 |
Synonyms | GALT2; B3GALT20; At4g21060; T13K14.220; Hydroxyproline O-galactosyltransferase GALT2; AtGALT2; Beta-1,3-galactosyltransferase 20 |
UniProt ID | A7XDQ9 |
◆ Recombinant Proteins | ||
TRIP4-4784Z | Recombinant Zebrafish TRIP4 | +Inquiry |
GBP3-6245M | Recombinant Mouse GBP3 Protein | +Inquiry |
TRPV2-5961R | Recombinant Rat TRPV2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HTRA2-2178R | Recombinant Rhesus monkey HTRA2 Protein, His-tagged | +Inquiry |
FABP3-5858C | Recombinant Cattle FABP3 protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
PLAU-31777TH | Native Human Human SERPINE1 | +Inquiry |
PGN-17S | Native S. aureus PGN Protein | +Inquiry |
Factor B-60H | Native Human Factor B | +Inquiry |
MAP-30 | Native Mytilus edulis MAP Protein | +Inquiry |
TF-002H | Native Human TF Protein, Rhodamine Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM71-933HCL | Recombinant Human TMEM71 293 Cell Lysate | +Inquiry |
ZER1-189HCL | Recombinant Human ZER1 293 Cell Lysate | +Inquiry |
APOL3-8776HCL | Recombinant Human APOL3 293 Cell Lysate | +Inquiry |
DERL3-224HCL | Recombinant Human DERL3 lysate | +Inquiry |
ADRBK2-13HCL | Recombinant Human ADRBK2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GALT2 Products
Required fields are marked with *
My Review for All GALT2 Products
Required fields are marked with *
0
Inquiry Basket