Recombinant Full Length Arabidopsis Thaliana Probable Beta-1,3-Galactosyltransferase 17(B3Galt17) Protein, His-Tagged
Cat.No. : | RFL30397AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 17(B3GALT17) Protein (Q8GXG6) (1-673aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-673) |
Form : | Lyophilized powder |
AA Sequence : | MKKSKLDNSSSQIRFGLVQFLLVVLLFYFLCMSFEIPFIFRTGSGSGSDDVSSSSFADAL PRPMVVGGGSREANWVVGEEEEADPHRHFKDPGRVQLRLPERKMREFKSVSEIFVNESFF DNGGFSDEFSIFHKTAKHAISMGRKMWDGLDSGLIKPDKAPVKTRIEKCPDMVSVSESEF VNRSRILVLPCGLTLGSHITVVATPHWAHVEKDGDKTAMVSQFMMELQGLKAVDGEDPPR ILHFNPRIKGDWSGRPVIEQNTCYRMQWGSGLRCDGRESSDDEEYVDGEVKCERWKRDDD DGGNNGDDFDESKKTWWLNRLMGRRKKMITHDWDYPFAEGKLFVLTLRAGMEGYHISVNG RHITSFPYRTGFVLEDATGLAVKGNIDVHSVYAASLPSTNPSFAPQKHLEMQRIWKAPSL PQKPVELFIGILSAGNHFAERMAVRKSWMQQKLVRSSKVVARFFVALHARKEVNVDLKKE AEYFGDIVIVPYMDHYDLVVLKTVAICEYGVNTVAAKYVMKCDDDTFVRVDAVIQEAEKV KGRESLYIGNINFNHKPLRTGKWAVTFEEWPEEYYPPYANGPGYILSYDVAKFIVDDFEQ KRLRLFKMEDVSMGMWVEKFNETRPVAVVHSLKFCQFGCIEDYFTAHYQSPRQMICMWDK LQRLGKPQCCNMR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GALT4 |
Synonyms | GALT4; B3GALT17; At1g27120; T7N9.18; Hydroxyproline O-galactosyltransferase GALT4; Beta-1,3-galactosyltransferase 17 |
UniProt ID | Q8GXG6 |
◆ Recombinant Proteins | ||
SERPINA3-487H | Recombinant Human SERPINA3 | +Inquiry |
FASLG-2180P | Recombinant Pig FASLG Protein, His&SUMO-tagged | +Inquiry |
ACTR1A-226R | Recombinant Rhesus monkey ACTR1A Protein, His-tagged | +Inquiry |
SSUH2-3793HF | Recombinant Full Length Human SSUH2 Protein, GST-tagged | +Inquiry |
PKN1-1289H | Recombinant Human Protein Kinase N1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Chymotrypsin-163B | Active Native Bovine Chymotrypsin | +Inquiry |
Casein-01B | Active Native Bovine Casein Protein | +Inquiry |
Laminin-33H | Native Human Laminin protein | +Inquiry |
LDL-403H | Native Human Low Density Lipoprotein, Oxidized, DiO labeled | +Inquiry |
GPT-26882TH | Native Human GPT | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM113B-6451HCL | Recombinant Human FAM113B 293 Cell Lysate | +Inquiry |
CTNS-7198HCL | Recombinant Human CTNS 293 Cell Lysate | +Inquiry |
WDYHV1-324HCL | Recombinant Human WDYHV1 293 Cell Lysate | +Inquiry |
H2AFZ-5655HCL | Recombinant Human H2AFZ 293 Cell Lysate | +Inquiry |
TF-001RCL | Recombinant Rat TF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GALT4 Products
Required fields are marked with *
My Review for All GALT4 Products
Required fields are marked with *
0
Inquiry Basket