Recombinant Full Length Arabidopsis Thaliana Probable Beta-1,3-Galactosyltransferase 14(B3Galt14) Protein, His-Tagged
Cat.No. : | RFL23833AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 14(B3GALT14) Protein (Q8L7M1) (1-345aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-345) |
Form : | Lyophilized powder |
AA Sequence : | MHSPRKLFHARSSLATRRSTALVVLTSLAIGIAGFTFGLAVILIPGLRLTGRNCLTNTPP KTVRVVWDVAGNSNGVVSGEKKRHKVMGFVGIQTGFGSAGRRRSLRKTWMPSDPEGLRRL EESTGLAIRFMIGKTKSEEKMAQLRREIAEYDDFVLLDIEEEYSKLPYKTLAFFKAAYAL YDSEFYVKADDDIYLRPDRLSLLLAKERSHSQTYLGCLKKGPVFTDPKLKWYEPLSHLLG KEYFLHAYGPIYALSADVVASLVALKNNSFRMFNNEDVTIGAWMLAMNVNHENHHILCEP ECSPSSVAVWDIPKCSGLCNPEKRMLELHKQESCSKSPTLPSDDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | B3GALT14 |
Synonyms | B3GALT14; At1g53290; F12M16.19; Probable beta-1,3-galactosyltransferase 14 |
UniProt ID | Q8L7M1 |
◆ Recombinant Proteins | ||
FGF3-518H | Active Recombinant Human Fibroblast Growth Factor 3 | +Inquiry |
IGFBP6-5053H | Active Recombinant Human IGFBP6 protein | +Inquiry |
RFL2562VF | Recombinant Full Length Vibrio Harveyi Upf0761 Membrane Protein Vibhar_00593 (Vibhar_00593) Protein, His-Tagged | +Inquiry |
KIF1C-1433R | Recombinant Rat KIF1C Protein (1-272 aa), His-tagged | +Inquiry |
SNRPE-11237Z | Recombinant Zebrafish SNRPE | +Inquiry |
◆ Native Proteins | ||
HP-133B | Native Bovine Haptoglobin | +Inquiry |
C3a-08H | Native Human Complement C3 alpha protein | +Inquiry |
ighg1-160M | Native Mouse Immunoglobulin G1 | +Inquiry |
GPT-1840H | Active Native Human GPT | +Inquiry |
TRIM21-212B | Native Cow TRIM21 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC3-4637HCL | Recombinant Human LRRC3 293 Cell Lysate | +Inquiry |
HLA-DRB3-798HCL | Recombinant Human HLA-DRB3 cell lysate | +Inquiry |
ACPT-16HCL | Recombinant Human ACPT cell lysate | +Inquiry |
DHX40-6928HCL | Recombinant Human DHX40 293 Cell Lysate | +Inquiry |
SLC9A8-1692HCL | Recombinant Human SLC9A8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All B3GALT14 Products
Required fields are marked with *
My Review for All B3GALT14 Products
Required fields are marked with *
0
Inquiry Basket