Recombinant Full Length Arabidopsis Thaliana Probable Beta-1,3-Galactosyltransferase 1(B3Galt1) Protein, His-Tagged
Cat.No. : | RFL31124AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 1(B3GALT1) Protein (Q9SAA4) (1-384aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-384) |
Form : | Lyophilized powder |
AA Sequence : | MSFKNRGDYNFTPRNVVSRNSVFFMCLASFCLGMFFTNRMWNIVPEARGISRLSKLSLSS SDCDKKNVLDYGNNTIGILDKSISNLEMKLVAARAERESLSGKFNISNEAKKRKYFMVIG INTAFSSRKRRDSVRSTWMPQGENLKKLEEEKGIIVRFVIGHSVLSHGILDKAIEAEEKT HGDFLRLEHTEGYMKLSAKTKTFFATAVSLWDAEFYIKVDDDVHVNLASLKKALSAHQNK PRVYVGCMKSGPVLARKSVKYHEPEYWKFGEVGNKYFRHATGQFYAISKDLATYILINQD LLHKYANEDVSLGSWFIGLNVEHVDEKRLCCSTSQDCELKAMMGHVCAASFDWKCSGICR SAERMADVHERCGEPQNALWTSNS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | B3GALT1 |
Synonyms | B3GALT1; At1g11730; F25C20.12; Probable beta-1,3-galactosyltransferase 1 |
UniProt ID | Q9SAA4 |
◆ Recombinant Proteins | ||
BBS7-111H | Recombinant Human BBS7 Protein, GST-tagged | +Inquiry |
ITM2C-3121R | Recombinant Rat ITM2C Protein | +Inquiry |
HOXA13-4277M | Recombinant Mouse HOXA13 Protein, His (Fc)-Avi-tagged | +Inquiry |
STAT1-4516R | Recombinant Rhesus monkey STAT1 Protein, His-tagged | +Inquiry |
YOKL-2519B | Recombinant Bacillus subtilis YOKL protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
SERPINA1-8009H | Native Human Serum Alpha 1 AntiTrypsin | +Inquiry |
APOC3-8040H | Native Human ApoLipoprotein CIII | +Inquiry |
ALB-198B | Native Bovine ALB protein, methylated | +Inquiry |
TIMP1-91B | Active Native Bovine Thrombin | +Inquiry |
CP-8073H | Native Human Plasma Ceruloplasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKAP14-8940HCL | Recombinant Human AKAP14 293 Cell Lysate | +Inquiry |
ACSL3-9076HCL | Recombinant Human ACSL3 293 Cell Lysate | +Inquiry |
CYP4X1-441HCL | Recombinant Human CYP4X1 cell lysate | +Inquiry |
TSR2-697HCL | Recombinant Human TSR2 293 Cell Lysate | +Inquiry |
Epididymis-639B | Bovine Epididymis Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All B3GALT1 Products
Required fields are marked with *
My Review for All B3GALT1 Products
Required fields are marked with *
0
Inquiry Basket