Recombinant Full Length Arabidopsis Thaliana Probable 3-Ketoacyl-Coa Synthase 20(Kcs20) Protein, His-Tagged
Cat.No. : | RFL25098AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable 3-ketoacyl-CoA synthase 20(KCS20) Protein (Q9FH27) (1-464aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-464) |
Form : | Lyophilized powder |
AA Sequence : | MNQTIHRVSPISMSISELTTLLSSGVSVFEIFAGLLVVHLIYQRIRTRVKVYLLDFTCYR APDSNRVPMSTLIETIYLDDKLDQESIDFQARILERSWLSNQTSIPRSLMEIPLKKSLSS VKIETMTTIFTSVEDLLRKNKLSPRSIDILITNCSLHSPSPSLSAMVINKFHMRSNIKSF NLSGMGCAAGILSVNLANDLLQAHRGSLALIVSTEALNTHWYIGKDRSMLLTNCLFRMGA AAVLMSSNDHDRDNAKYELLHVVRKNKAKDDRAYRCIYQDIDSDEKQGVSITKDVISVAG DMLKMNLTSLGPLVLPYLEQFQYVIQHILCKKLKIYESNSSYTPNFKTAFEHFCIHTGGR AVIQAMEMNLKLTKVDIEPSKMTLHRFGNTSSSSIWYALSYLEAKRRMKKGDRVLQIAFG SGFKCNSAVWRCIRKVEPNTENKWLDFIDSYPVDVPDSTNIRPG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCS21 |
Synonyms | KCS21; KCS20; At5g49070; K20J1.4; Probable 3-ketoacyl-CoA synthase 21; KCS-21; Very long-chain fatty acid condensing enzyme 21; VLCFA condensing enzyme 21 |
UniProt ID | Q9FH27 |
◆ Recombinant Proteins | ||
LMTK3-732H | Recombinant Human LMTK3 Protein, MYC/DDK-tagged | +Inquiry |
Tex11-6363M | Recombinant Mouse Tex11 Protein, Myc/DDK-tagged | +Inquiry |
CNTNAP5C-1169R | Recombinant Rat CNTNAP5C Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMC4-4441R | Recombinant Rat PSMC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Sptan1-34M | Recombinant Mouse Sptan1, His-tagged | +Inquiry |
◆ Native Proteins | ||
Prethrombin-2-294M | Native Mouse Prethrombin-2 | +Inquiry |
Lipoprotein-246 | Native Human Oxidized LDL (Ox-LDL) | +Inquiry |
Tnnt2-7425M | Native Mouse Tnnt2 Protein | +Inquiry |
a-Actinin-20C | Native Chicken a-Actinin Protein | +Inquiry |
Gamma Globulin-72H | Native Human Gamma Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
BBS10-157HCL | Recombinant Human BBS10 cell lysate | +Inquiry |
EIF4G3-6645HCL | Recombinant Human EIF4G3 293 Cell Lysate | +Inquiry |
KGFLP1-357HCL | Recombinant Human KGFLP1 lysate | +Inquiry |
GZMA-5668HCL | Recombinant Human GZMA 293 Cell Lysate | +Inquiry |
SNX15-1660HCL | Recombinant Human SNX15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCS21 Products
Required fields are marked with *
My Review for All KCS21 Products
Required fields are marked with *
0
Inquiry Basket