Recombinant Full Length Arabidopsis Thaliana Probable 3-Ketoacyl-Coa Synthase 14(Kcs14) Protein, His-Tagged
Cat.No. : | RFL32828AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable 3-ketoacyl-CoA synthase 14(KCS14) Protein (Q9SS39) (26-459aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (26-459) |
Form : | Lyophilized powder |
AA Sequence : | LHFHHDFFSPFPVKIGLLLISIFFYAYSTTRSKPVYLVDFSCHQPTDSCKISSETFFNMA KGAQLYTEETIQFMTRILNRSGLGDDTYSPRCMLTSPPTPSMYEARHESELVIFGALNSL FKKTGIEPREVGIFIVNCSLFNPNPSLSSMIVNRYKLKTDVKTYNLSGISVDLATNLLKA NPNTYAVIVSTENMTLSMYRGNDRSMLVPNCLFRVGGAAVMLSNRSQDRVRSKYELTHIV RTHKGSSDKHYTCAEQKEDSKGIVGVALSKELTVVAGDTLKTNLTALGPLVLPLSEKLRF ILFLVKSKLFRLKVSPYVPDFKLCFKHFCIHAGGRALLDAVEKGLGLSEFDLEPSRMTLH RFGNTSSSSLWYELAYVEAKCRVKRGDRVWQLAFGSGFKCNSIVWRALRTIPANESLVGN PWGDSVHKYPVHVT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCS14 |
Synonyms | KCS14; At3g10280; F14P13.12; Probable 3-ketoacyl-CoA synthase 14; KCS-14; Very long-chain fatty acid condensing enzyme 14; VLCFA condensing enzyme 14 |
UniProt ID | Q9SS39 |
◆ Recombinant Proteins | ||
DAG1-1174R | Recombinant Rhesus monkey DAG1 Protein, His-tagged | +Inquiry |
GPR110-3839M | Recombinant Mouse GPR110 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPS6KA2-3740H | Recombinant Human RPS6KA2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRDM9-4657R | Recombinant Rat PRDM9 Protein | +Inquiry |
IL24-589H | Recombinant Human IL24 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HP-146R | Native Rabbit Hemoglobin | +Inquiry |
Lectin-1809M | Active Native Maackia Amurensis Lectin II Protein, Biotinylated | +Inquiry |
HSV1-15 | Native Herpes Simplex Virus (HSV) Type 1 Antigen | +Inquiry |
MPOC-235H | Active Native Human Myeloperoxidase Isoform C | +Inquiry |
Lectin-1838S | Active Native Sambucus Nigra Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
Corpus-637B | Bovine Corpus Luteum Lysate, Total Protein | +Inquiry |
Liver-085RCL | Adult Rat Liver Whole Cell Lysate | +Inquiry |
LSM4-9173HCL | Recombinant Human LSM4 293 Cell Lysate | +Inquiry |
SPRTN-222HCL | Recombinant Human SPRTN cell lysate | +Inquiry |
ENDOV-645HCL | Recombinant Human ENDOV cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCS14 Products
Required fields are marked with *
My Review for All KCS14 Products
Required fields are marked with *
0
Inquiry Basket