Recombinant Full Length Arabidopsis Thaliana Phosphatidate Cytidylyltransferase(Cds1) Protein, His-Tagged
Cat.No. : | RFL28904AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Phosphatidate cytidylyltransferase(CDS1) Protein (O04928) (1-421aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-421) |
Form : | Lyophilized powder |
AA Sequence : | MEEENVTSSPSTPVHRLRHRRRSNEVVTDGDKVNASPLLVNDRNKYKSFMVRTYSTLWMI GGFVLVVYMGHLYITAMVVVIQIFMAKELFNLLRKAPEDKCLPYIKQLNWHFFFTAMLFV YGRILSQRLANTMTADQFFYRLVSGLIKYHMAICYLLYIIGFMWFILTLKKKMYKYQFGQ YAWTHMILIVVFTQSSFTVANIFEGIFWFLLPASLIIINDIFAYIFGFFFGRTPLIKLSP KKTWEGFIGASVTTIISAFVLANILGRFPWLTCPRQDLSTGWLQCDADPLFKPEPFALPA WIPEWFPWKEMTILPVQWHALCLGLFASIIAPFGGFFASGFKRAFKIKDFGDSIPGHGGI TDRMDCQMVMAVFAYIYLQSFIVSQSVSVDKILDQILTNLTFEEQQALFVKLGQMLKDKL S |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CDS1 |
Synonyms | CDS1; At1g62430; F24O1.17; Phosphatidate cytidylyltransferase 1; CDP-DAG synthase 1; CDP-DG synthase 1; CDP-diacylglycerol synthase 1; CDS1; CDP-diglyceride pyrophosphorylase 1; CDP-diglyceride synthase 1; CTP:phosphatidate cytidylyltransferase 1 |
UniProt ID | O04928 |
◆ Recombinant Proteins | ||
BCL2L11-7198Z | Recombinant Zebrafish BCL2L11 | +Inquiry |
RDH10-4978R | Recombinant Rat RDH10 Protein | +Inquiry |
RFL19187BF | Recombinant Full Length Brucella Ovis Protease Htpx Homolog(Htpx) Protein, His-Tagged | +Inquiry |
RFL32401RF | Recombinant Full Length Rat Frizzled-5(Fzd5) Protein, His-Tagged | +Inquiry |
OR6C4-3048R | Recombinant Rhesus Macaque OR6C4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
SPARC-287B | Native Bovine Osteonectin | +Inquiry |
Lectin-1775E | Active Native Erythrina Cristagalli Lectin Protein | +Inquiry |
Immunoglobulin G4-84H | Native Human Immunoglobulin G4 | +Inquiry |
F5-1176H | Native Human Coagulation Factor V, FITC conjugated | +Inquiry |
AMY1A-5313H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGL2-2390HCL | Recombinant Human RGL2 293 Cell Lysate | +Inquiry |
ADAM32-9034HCL | Recombinant Human ADAM32 293 Cell Lysate | +Inquiry |
Neuro-2a-1186M | Neuro-2a (mouse neuroblastoma) whole cell lysate | +Inquiry |
C6-1647HCL | Recombinant Human C6 cell lysate | +Inquiry |
ALG1-8909HCL | Recombinant Human ALG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CDS1 Products
Required fields are marked with *
My Review for All CDS1 Products
Required fields are marked with *
0
Inquiry Basket