Recombinant Full Length Arabidopsis Thaliana Mlo-Like Protein 12(Mlo12) Protein, His-Tagged
Cat.No. : | RFL14144AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana MLO-like protein 12(MLO12) Protein (O80961) (1-576aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-576) |
Form : | Lyophilized powder |
AA Sequence : | MAIKERSLEETPTWAVAVVCFVLLFISIMIEYFLHFIGHWFKKKHKKALSEALEKVKAEL MLLGFISLLLVVLQTPVSEICIPRNIAATWHPCSNHQEIAKYGKDYIDDGRKILEDFDSN DFYSPRRNLATKGYDKCAEKGKVALVSAYGIHQLHIFIFVLAVFHVLYCIITYALGKTKM KKWKSWERETKTIEYQYANDPERFRFARDTSFGRRHLNIWSKSTFTLWITCFFRQFFGSV TKVDYLTLRHGFIMAHLPAGSAARFDFQKYIERSLEQDFTVVVGISPLIWCIAVLFILTN THGWDSYLWLPFLPLIVILIVGAKLQMIISKLGLRIQEKGDVVKGAPVVEPGDDLFWFGR PRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNCFHHKTEDIAIRITMGVLIQVLCSYIT LPLYALVTQMGTSMRPTIFNDRVANALKKWHHTAKKQTKHGHSGSNTPHSSRPTTPTHGM SPVHLLHNYNNRSLDQQTSFTASPSPPRFSDYSGQGHGHQHFFDPESQNHSYQREITDSE FSNSHHPQVDMASPVREEKEIVEHVKVDLSEFTFKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MLO12 |
Synonyms | MLO12; At2g39200; T16B24.16; MLO-like protein 12; AtMlo12; AtMlo18 |
UniProt ID | O80961 |
◆ Recombinant Proteins | ||
INHBE-4550M | Recombinant Mouse INHBE Protein, His (Fc)-Avi-tagged | +Inquiry |
TUB-17607M | Recombinant Mouse TUB Protein | +Inquiry |
HA-347I | Active Recombinant Influenza A H9N2 (A/Guinea fowl/Hong Kong/WF10/99) HA Protein, His & Avi-tagged, Biotinylated | +Inquiry |
ATG13-10741Z | Recombinant Zebrafish ATG13 | +Inquiry |
ERN1-1021H | Active Recombinant Human ERN1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
MG-41H | Active Native Human MG | +Inquiry |
TFRC-16H | Native Human Apotransferrin Protein | +Inquiry |
ATF-180M | Native Mouse Apotransferrin | +Inquiry |
Lectin-1827P | Active Native Pisum Sativum Agglutinin Protein, Agarose bound | +Inquiry |
Elastase-26P | Native Pseudomonas Aeruginosa Elastase | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR45-346HCL | Recombinant Human WDR45 293 Cell Lysate | +Inquiry |
VPS35-389HCL | Recombinant Human VPS35 293 Cell Lysate | +Inquiry |
RBM12-2480HCL | Recombinant Human RBM12 293 Cell Lysate | +Inquiry |
GCLM-5982HCL | Recombinant Human GCLM 293 Cell Lysate | +Inquiry |
GGPS1-5946HCL | Recombinant Human GGPS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MLO12 Products
Required fields are marked with *
My Review for All MLO12 Products
Required fields are marked with *
0
Inquiry Basket