Recombinant Full Length Arabidopsis Thaliana Mlo-Like Protein 10(Mlo10) Protein, His-Tagged
Cat.No. : | RFL12220AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana MLO-like protein 10(MLO10) Protein (Q9FKY5) (1-569aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-569) |
Form : | Lyophilized powder |
AA Sequence : | MATRCFWCWTTLLFCSQLLTGFARASSAGGAKEKGLSQTPTWAVALVCTFFILVSVLLEK ALHRVATWLWEKHKNSLLEALEKIKAELMILGFISLLLTFGEQYILKICIPEKAAASMLP CPAPSTHDQDKTHRRRLAAATTSSRCDEGHEPLIPATGLHQLHILLFFMAAFHILYSFIT MMLGRLKIRGWKKWEQETCSHDYEFSIDPSRFRLTHETSFVRQHSSFWTKIPFFFYAGCF LQQFFRSVGRTDYLTLRHGFIAAHLAPGRKFDFQKYIKRSLEDDFKVVVGISPLLWASFV IFLLLNVNGWEALFWASILPVLIILAVSTKLQAILTRMALGITERHAVVQGIPLVHGSDK YFWFNRPQLLLHLLHFALFQNAFQLTYFFWVWYSFGLKSCFHTDFKLVIVKLSLGVGALI LCSYITLPLYALVTQMGSNMKKAVFDEQMAKALKKWHMTVKKKKGKARKPPTETLGVSDT VSTSTSSFHASGATLLRSKTTGHSTASYMSNFEDQSMSDLEAEPLSPEPIEGHTLVRVGD QNTEIEYTGDISPGNQFSFVKNVPANDID |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MLO10 |
Synonyms | MLO10; At5g65970; K2A18.3; MLO-like protein 10; AtMlo10 |
UniProt ID | Q9FKY5 |
◆ Recombinant Proteins | ||
IGF2-559H | Recombinant Human IGF2 Protein, Fc-tagged | +Inquiry |
MAPKAPK25360H | Recombinant Human MAPKAP Kinase 2 (41-364) Protein | +Inquiry |
RFL7950HF | Recombinant Full Length Haemophilus Ducreyi Upf0756 Membrane Protein Hd_1071(Hd_1071) Protein, His-Tagged | +Inquiry |
DNPH1-2681HF | Recombinant Full Length Human DNPH1 Protein, GST-tagged | +Inquiry |
PRDX2-2247H | Recombinant Human PRDX2 Protein (2-198 aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
PLD-18A | Active Native Arachis hypogaea (peanut) Phospholipase D, Type II | +Inquiry |
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
IgA-239S | Native Sheep Immunoglobulin A | +Inquiry |
ORM1-8016R | Native Rabbit Serum Alpha-1-Acid GlycoProtein | +Inquiry |
BGLAP-60H | Native Human BGLAP protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL4-4170HCL | Recombinant Human MRPL4 293 Cell Lysate | +Inquiry |
ZNF101-146HCL | Recombinant Human ZNF101 293 Cell Lysate | +Inquiry |
IGFBP4-2925MCL | Recombinant Mouse IGFBP4 cell lysate | +Inquiry |
IFNA5-001MCL | Recombinant Mouse IFNA5 cell lysate | +Inquiry |
KRTAP10-7-4857HCL | Recombinant Human KRTAP10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MLO10 Products
Required fields are marked with *
My Review for All MLO10 Products
Required fields are marked with *
0
Inquiry Basket