Recombinant Full Length Arabidopsis Thaliana Metal Tolerance Protein A2(Mtpa2) Protein, His-Tagged
Cat.No. : | RFL11903AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Metal tolerance protein A2(MTPA2) Protein (Q9LXS1) (1-393aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-393) |
Form : | Lyophilized powder |
AA Sequence : | MVTPKLHLDLSLTKKMKDHIHEHDHMVQICGEVSSGETSLVGIKKTCGEAPCGFSDAKTS SIEAQERAASMRKLLIAVLLCAIFIVVEVVGGIKANSLAILTDAAHLLSDVAAFAISLFS LWASGWKANPQQSYGFFRIEILGALVSIQMIWLLAGILVYEAIVRLNNGSGEVEGSLMFA VSAVGLLVNIAMAILLGHDHGHGHGHSHDNGHGHSHDHGHGIAATEHHHDSGHDESQLSD VLIEQKKQRNVNIQGAYLHVLGDSIQSVGVMIGGAIIWYKPEWKILDLICTLVFSVIVLG TTIGMLRNILEVLMESTPREIDPTMLEKGVCEIEEVVAVHELHIWAITVGKLLLACHVKI RPEAEADMVLDKIIDYIKREHNISHVTIQIERQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MTPA2 |
Synonyms | MTPA2; MTP3; At3g58810; T20N10_160; Metal tolerance protein A2; AtMTP3; AtMTPa2 |
UniProt ID | Q9LXS1 |
◆ Recombinant Proteins | ||
ITFG2-4632M | Recombinant Mouse ITFG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYL4-30265TH | Recombinant Human MYL4, His-tagged | +Inquiry |
COL27A1-1859M | Recombinant Mouse COL27A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ctns-2363M | Recombinant Mouse Ctns Protein, Myc/DDK-tagged | +Inquiry |
TGFB1-3209H | Recombinant Human TGFB1, His-tagged | +Inquiry |
◆ Native Proteins | ||
TF-135R | Native Rabbit Transferrin | +Inquiry |
Batroxobin-99 | Native Bothrops atrox snake venom Batroxobin Protein | +Inquiry |
Collagen-325H | Native Human Collagen Type I | +Inquiry |
AFP-1180H | Native Human Alpha-Fetoprotein | +Inquiry |
HP-192F | Native Feline Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD274-002RCL | Recombinant Rat CD274 cell lysate | +Inquiry |
MYL12A-4030HCL | Recombinant Human MYL12A 293 Cell Lysate | +Inquiry |
PDZRN3-1329HCL | Recombinant Human PDZRN3 cell lysate | +Inquiry |
NRARP-3703HCL | Recombinant Human NRARP 293 Cell Lysate | +Inquiry |
MYL6-4023HCL | Recombinant Human MYL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTPA2 Products
Required fields are marked with *
My Review for All MTPA2 Products
Required fields are marked with *
0
Inquiry Basket