Recombinant Full Length Arabidopsis Thaliana Magnesium Transporter Mrs2-7(Mrs2-7) Protein, His-Tagged
Cat.No. : | RFL11659AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Magnesium transporter MRS2-7(MRS2-7) Protein (Q304A0) (1-386aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-386) |
Form : | Lyophilized powder |
AA Sequence : | MSPDGELVPVDSSAVVTAKRKTSQLSRSWISIDATGQKTVLDVDKHVIMHRVQIHARDLR ILDPNLFYPSAILGRERAIVLNLEHIKAIITAEEVLIRDSSDENVIPVLEEFQRRLPVGN EAHGVHGDGDLGEEDESPFEFRALEVALEAICSFLAARTTELEKFAYPALDELTLKISSR NLERVRKLKSAMTRLTARVQKVRDELEQLLDDDGDMADLYLTRKLVGASSSVSVSDEPIW YPTSPTIGSMISRASRVSLVTVRGDDETDVEELEMLLEAYFMQIDSTLNKLTELREYIDD TEDYINIQLDNHRNQLIQLELMLSAGTVCVSVYSMIAGIFGMNIPNTWNHDHGYIFKWVV SLTGTFCIVLFVIILSYARFRGLIGS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2-7 |
Synonyms | MRS2-7; MGT7; At5g09690; F17I14.120; Magnesium transporter MRS2-7; Magnesium Transporter 7; AtMGT7 |
UniProt ID | Q304A0 |
◆ Recombinant Proteins | ||
GNA13B-2071Z | Recombinant Zebrafish GNA13B | +Inquiry |
DCTN5-1172H | Recombinant Human DCTN5 Protein, GST/His-tagged | +Inquiry |
ROR2-5879H | Recombinant Human ROR2 Protein (Glu34-Tyr406), C-His tagged | +Inquiry |
RIPPLY3-7620M | Recombinant Mouse RIPPLY3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMD12-3669R | Recombinant Rhesus monkey PSMD12 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CNAN-133A | Native Arachis hypogaea seed Conarachin | +Inquiry |
HP-192F | Native Feline Haptoglobin | +Inquiry |
Ferritin-181R | Native Rat Ferritin | +Inquiry |
Neuraminidase-012C | Active Native Clostridium perfringens Phospholipase C, Type I | +Inquiry |
IgG-353C | Native Chicken IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAL-4530HCL | Recombinant Human MAL 293 Cell Lysate | +Inquiry |
CD27-1156CCL | Recombinant Cynomolgus CD27 cell lysate | +Inquiry |
DDX27-7012HCL | Recombinant Human DDX27 293 Cell Lysate | +Inquiry |
KIF14-925HCL | Recombinant Human KIF14 cell lysate | +Inquiry |
WDR92-327HCL | Recombinant Human WDR92 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MRS2-7 Products
Required fields are marked with *
My Review for All MRS2-7 Products
Required fields are marked with *
0
Inquiry Basket