Recombinant Full Length Arabidopsis Thaliana Magnesium Transporter Mrs2-2(Mrs2-2) Protein, His-Tagged
Cat.No. : | RFL25194AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Magnesium transporter MRS2-2(MRS2-2) Protein (Q9FLG2) (1-394aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-394) |
Form : | Lyophilized powder |
AA Sequence : | MAQNGYLVPADPSAVVTVKKKTPQASWALIDATGQSEPLDVDKYEIMHRVQIHARDLRIL DPNLSYPSTILGRERAIVLNLEHIKAIITSEEVLLRDPSDENVIPVVEELRRRLPVGNAS HNGGQGDGKEIAGAQNDGDTGDEDESPFEFRALEVALEAICSFLAARTAELETAAYPALD ELTSKISSRNLDRVRKLKSAMTRLTARVQKVRDELEQLLDDDDDMADLYLSRKLSSASSP ISSIGEPNWYTTSPTIGSKISRASRASLATVHGDENDVEELEMLLEAYFMQIDSTLNRLT TLREYIDDTEDYINIQLDNHRNQLIQLELVLSSGTVCLSMYSLVAGIFGMNIPYTWNDGH GYMFKYVVGLTGTLCVVVFVIIMSYARYKGLVGS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2-2 |
Synonyms | MRS2-2; MGT9; At5g64560; MUB3.8; Magnesium transporter MRS2-2; Magnesium Transporter 9; AtMGT9 |
UniProt ID | Q9FLG2 |
◆ Native Proteins | ||
Brain-10H | Native Human Brain Tissue Protein/Lysate | +Inquiry |
Pa-27F | Native Feline Parvovirus Antigen | +Inquiry |
Lectin-1822P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Agarose bound | +Inquiry |
IgD-213H | Native Human Immunoglobulin D (IgD) | +Inquiry |
Lectin-1755C | Active Native Canavalia ensiformis Concanavalin A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSTCL-3521HCL | Recombinant Human OSTCL 293 Cell Lysate | +Inquiry |
GIGYF1-5940HCL | Recombinant Human GIGYF1 293 Cell Lysate | +Inquiry |
TFDP2-1131HCL | Recombinant Human TFDP2 293 Cell Lysate | +Inquiry |
NOC2L-3774HCL | Recombinant Human NOC2L 293 Cell Lysate | +Inquiry |
TSPAN18-709HCL | Recombinant Human TSPAN18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRS2-2 Products
Required fields are marked with *
My Review for All MRS2-2 Products
Required fields are marked with *
0
Inquiry Basket