Recombinant Full Length Arabidopsis Thaliana Inner Membrane Protein Albino3, Chloroplastic(Alb3) Protein, His-Tagged
Cat.No. : | RFL18757AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Inner membrane protein ALBINO3, chloroplastic(ALB3) Protein (Q8LBP4) (57-462aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (57-462) |
Form : | Lyophilized powder |
AA Sequence : | SLNEIPPFHGLDSSVDIGAIFTRAESLLYTIADAAVVGADSVVTTDSSAVQKSGGWFGFI SDAMELVLKILKDGLSAVHVPYAYGFAIILLTIIVKAATYPLTKQQVESTLAMQNLQPKI KAIQQRYAGNQERIQLETSRLYKQAGVNPLAGCLPTLATIPVWIGLYQALSNVANEGLFT EGFFWIPSLGGPTSIAARQSGSGISWLFPFVDGHPPLGWYDTVAYLVLPVLLIASQYVSM EIMKPPQTDDPAQKNTLLVFKFLPLMIGYFALSVPSGLSIYWLTNNVLSTAQQVYLRKLG GAKPNMDENASKIISAGRAKRSIAQPDDAGERFRQLKEQEKRSKKNKAVAKDTVELVEES QSESEEGSDDEEEEAREGALASSTTSKPLPEVGQRRSKRSKRKRTV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ALB3 |
Synonyms | ALB3; At2g28800; F8N16.9; Inner membrane protein ALBINO3, chloroplastic |
UniProt ID | Q8LBP4 |
◆ Recombinant Proteins | ||
FABP4-1361R | Recombinant Rhesus Macaque FABP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL682CF | Recombinant Full Length Chromohalobacter Salexigens Nadh-Quinone Oxidoreductase Subunit A(Nuoa) Protein, His-Tagged | +Inquiry |
TIMM8A1-6073R | Recombinant Rat TIMM8A1 Protein | +Inquiry |
FGF1-159C | Active Recombinant Canine FGF1 protein | +Inquiry |
TCF3A-8720Z | Recombinant Zebrafish TCF3A | +Inquiry |
◆ Native Proteins | ||
Myh2-13R | Active Native Rabbit Myosin II Protein | +Inquiry |
AFP-8027H | Native Human Alpha FetoProtein | +Inquiry |
Complement C5a-54H | Native Human Complement C5a | +Inquiry |
Plg-291M | Active Native Mouse glu-Plasminogen | +Inquiry |
MPOA-233H | Native Human Myeloperoxidase Isoform A | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAP2C-2523HCL | Recombinant Human RAP2C 293 Cell Lysate | +Inquiry |
SGSM3-1883HCL | Recombinant Human SGSM3 293 Cell Lysate | +Inquiry |
GNAI3-5869HCL | Recombinant Human GNAI3 293 Cell Lysate | +Inquiry |
NUCKS1-445HCL | Recombinant Human NUCKS1 lysate | +Inquiry |
WAC-371HCL | Recombinant Human WAC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ALB3 Products
Required fields are marked with *
My Review for All ALB3 Products
Required fields are marked with *
0
Inquiry Basket