Recombinant Full Length Arabidopsis Thaliana Glycerol-3-Phosphate Acyltransferase 7(Gpat7) Protein, His-Tagged
Cat.No. : | RFL5930AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Glycerol-3-phosphate acyltransferase 7(GPAT7) Protein (Q9LHS7) (1-500aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-500) |
Form : | Lyophilized powder |
AA Sequence : | MESSTTTSYSVVSELEGTLLKNPKPFAYFMLVAFEASGLIRFATLLFLWPIIALLDVLGY RNGSLKLMIFVATAGLHESEIESVARAVLPKFFMDDISMDAWRAFGSCDKRVVVTRMPRV MVERFAKDHLSADEVIGTEIVVNRFGYATGLIQETNVDQSVFNSVANLFVDRRPQLGLGR HIISDSPTFLSLCEEQVHAPVPSNYNGHNQRLHVQPLPVIFHDGRLVKLPTPATALIILL WIPFGIILAMIRIFVGFLLPLWAIPYVSRIFNTRFIVKGKPPAQATTGNPGVLFVCTHRT LMDPVVLSYVLGRSIPAVTYSISRLSEILSPIPTFRLTRIRDVDAEMIKKELSNGDLVVY PEGTTCREPFLLRFSALFAELTDNIVPVAMNYRVGFFHATTARGWKGLDPIFFFMNPRPV YEVTFLNQLEVEATCSSGKSPYDVANYVQRILAATLGFECTNFTRKDKYRVLAGNDGTVS YLSFLDQVKKVVTTFKPFLH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPAT7 |
Synonyms | GPAT7; At5g06090; K16F4.5; Glycerol-3-phosphate acyltransferase 7; AtGPAT7 |
UniProt ID | Q9LHS7 |
◆ Recombinant Proteins | ||
Il21r-1626C | Active Recombinant Cynomolgus Il21r protein, Fc-tagged | +Inquiry |
PNGaseF-2753P | Recombinant Pan-species (General) PNGaseF Protein, His-tagged | +Inquiry |
PTPN20B-4832R | Recombinant Rat PTPN20B Protein | +Inquiry |
U2AF1L4-6040R | Recombinant Rat U2AF1L4 Protein, His (Fc)-Avi-tagged | +Inquiry |
FCRLA-5800M | Recombinant Mouse FCRLA Protein | +Inquiry |
◆ Native Proteins | ||
TGFA-29704TH | Recombinant Human TGFA | +Inquiry |
Thrombin-23B | Native Bovine Thrombin | +Inquiry |
Lysostaphin-91S | Active Native Staphylococcus staphylolyticus Lysostaphin | +Inquiry |
Lectin-1842S | Active Native Solanum Tuberosum Lectin Protein, Biotinylated | +Inquiry |
HGF-38P | Native Porcine HGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
MICB-2885HCL | Recombinant Human MICB cell lysate | +Inquiry |
WDR61-339HCL | Recombinant Human WDR61 293 Cell Lysate | +Inquiry |
ARMC8-8699HCL | Recombinant Human ARMC8 293 Cell Lysate | +Inquiry |
Spleen-820H | Hamster Spleen Membrane Lysate, Total Protein | +Inquiry |
CTAG1B-7218HCL | Recombinant Human CTAG1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPAT7 Products
Required fields are marked with *
My Review for All GPAT7 Products
Required fields are marked with *
0
Inquiry Basket