Recombinant Full Length Arabidopsis Thaliana E3 Ubiquitin-Protein Ligase Orthrus-Like 1(Orthl) Protein, His-Tagged
Cat.No. : | RFL5999AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana E3 ubiquitin-protein ligase ORTHRUS-LIKE 1(ORTHL) Protein (Q681I0) (1-465aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-465) |
Form : | Lyophilized powder |
AA Sequence : | MTRVNQLPCDCVSTAEESLTSGTCITPTHVTSLSSPLDRSGDVDPLPVSDESGGSKADES MTDADETKKRKRILSGDCEADENNKSDGEIASLNDGVDAFTAICEDLNCSLCNQLPDRPV TILCGHNFCLKCFDKWIDQGNQICATCRSTIPDKMAANPRVNSSLVSVIRYVKVAKTAGV GTANFFPFTSNQDGPENAFRTKRAKIGEENAARIYVTVPFDHFGPIPAEHDPVRNQGVLV GESWENRVECRQWGVHLPHVSCIAGQEDYGAQSVVISGGYKDDEDHGEWFLYTGRSRGRH FANEDQEFEDLNEALRVSCEMGYPVRVVRSYKDRYSAYAPKEGVRYDGVYRIEKCWRKAR FPDSFKVCRYLFVRCDNEPAPWNSDESGDRPRPLPNIPELETASDLFERKESPSWDFDEA EGRWRWMKPPPANHEQRERMKMAMTCLLLFVLIILVGSSSILYQY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ORTHL |
Synonyms | ORTHL; ORL1; VIM6; At4g08590; T15F16.7; T3F12.10; E3 ubiquitin-protein ligase ORTHRUS-LIKE 1; ORTH-LIKE 1; Protein VARIANT IN METHYLATION 6; RING-type E3 ubiquitin transferase ORTHRUS-LIKE 1 |
UniProt ID | Q681I0 |
◆ Recombinant Proteins | ||
CSH1-3346H | Recombinant Human CSH1 Protein, MYC/DDK-tagged | +Inquiry |
PTPRC-468H | Recombinant Human PTPRC, GST-tagged, Active | +Inquiry |
Metrn-1544R | Recombinant Rat Metrn protein, His & T7-tagged | +Inquiry |
SPRY2-3538H | Recombinant Human SPRY2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RIPK1-36H | Active Recombinant Full Length Human RIPK1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Pectin-008A | Native Apple or Citrus fruits Pectin | +Inquiry |
AC-63B | Native Bovine Activated Protein C | +Inquiry |
Papain-149 | Active Native Immobilized Papain | +Inquiry |
TF-62H | Native Human Apo Transferrin Protein, Tag Free | +Inquiry |
TG-22P | Native Porcine Thyroglobulin (TG) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN6-7460HCL | Recombinant Human CLDN6 293 Cell Lysate | +Inquiry |
HLA-DRA-5501HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
TBL3-1211HCL | Recombinant Human TBL3 293 Cell Lysate | +Inquiry |
HSFY1-822HCL | Recombinant Human HSFY1 cell lysate | +Inquiry |
USP49-452HCL | Recombinant Human USP49 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ORTHL Products
Required fields are marked with *
My Review for All ORTHL Products
Required fields are marked with *
0
Inquiry Basket