Recombinant Full Length Arabidopsis Thaliana Duf246 Domain-Containing Protein At1G04910(At1G04910) Protein, His-Tagged
Cat.No. : | RFL2932AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana DUF246 domain-containing protein At1g04910(At1g04910) Protein (Q8W486) (1-519aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-519) |
Form : | Lyophilized powder |
AA Sequence : | MRRLGHHRLHGKTGGVGTKGMVAKLSIGVIVLLICTLSLLFSANIGSNREPTRPSKINVE ELWESAKSGGWRPSSAPRSDWPPPTKETNGYLRVRCNGGLNQQRSAICNAVLAARIMNAT LVLPELDANSFWHDDSGFQGIYDVEHFIETLKYDVKIVGKIPDVHKNGKTKKIKAFQIRP PRDAPIEWYLTTALKAMREHSAIYLTPFSHRLAEEIDNPEYQRLRCRVNYHALRFKPHIM KLSESIVDKLRSQGHFMSIHLRFEMDMLAFAGCFDIFNPEEQKILRKYRKENFADKRLIY NERRAIGKCPLTPEEVGLILRAMRFDNSTRIYLAAGELFGGEQFMKPFRTLFPRLDNHSS VDPSEELSATSQGLIGSAVDYMVCLLSDIFMPTYDGPSNFANNLLGHRLYYGFRTTIRPD RKALAPIFIAREKGKRAGFEEAVRRVMLKTNFGGPHKRVSPESFYTNSWPECFCQMNPKK SSDKCPPNNVIEILDSRLESIRDPDSTSQTNSTVTGLER |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OFUT1 |
Synonyms | OFUT1; At1g04910; F13M7.10; O-fucosyltransferase 1; O-FucT-1; O-fucosyltransferase family protein |
UniProt ID | Q8W486 |
◆ Recombinant Proteins | ||
Cul4b-2378M | Recombinant Mouse Cul4b Protein, Myc/DDK-tagged | +Inquiry |
Wbp4-6968M | Recombinant Mouse Wbp4 Protein, Myc/DDK-tagged | +Inquiry |
Srgap3-6126M | Recombinant Mouse Srgap3 Protein, Myc/DDK-tagged | +Inquiry |
RFL6162OF | Recombinant Full Length Ochrobactrum Anthropi Upf0060 Membrane Protein Oant_2511 (Oant_2511) Protein, His-Tagged | +Inquiry |
GLGD-0728B | Recombinant Bacillus subtilis GLGD protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CSH1-31024TH | Native Human CSH1 | +Inquiry |
LDH2-123H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
REN-245H | Active Native Human Renin | +Inquiry |
ACTN3-3280C | Native Chicken ACTN3 | +Inquiry |
HP-75C | Native Canine Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-DRA-5501HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
RFTN2-2402HCL | Recombinant Human RFTN2 293 Cell Lysate | +Inquiry |
HeLa-S3-01HL | Human HeLa-S3 lysate | +Inquiry |
CTTNBP2NL-7188HCL | Recombinant Human CTTNBP2NL 293 Cell Lysate | +Inquiry |
TCEAL3-657HCL | Recombinant Human TCEAL3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OFUT1 Products
Required fields are marked with *
My Review for All OFUT1 Products
Required fields are marked with *
0
Inquiry Basket