Recombinant Full Length Arabidopsis Thaliana Duf21 Domain-Containing Protein At1G47330(Cbsduf7) Protein, His-Tagged
Cat.No. : | RFL25594AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana DUF21 domain-containing protein At1g47330(CBSDUF7) Protein (Q8RY60) (1-527aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-527) |
Form : | Lyophilized powder |
AA Sequence : | MSSDIPCCGTTFSLYVVIIIALVAFAGLMAGLTLGLMSLGLVDLEVLIKSGRPQDRINAG KIFPVVKNQHLLLCTLLIGNSMAMEALPIFLDKIVPPWLAILLSVTLILVFGEIMPQAVC TRYGLKVGAIMAPFVRVLLVLFFPISYPISKVLDWMLGKGHGVLLRRAELKTFVNFHGNE AGKGGDLTTDETSIITGALELTEKTAKDAMTPISNAFSLELDTPLNLETLNTIMSVGHSR VPVYFRNPTHIIGLILVKNLLAVDARKEVPLRKMSMRKIPRVSETMPLYDILNEFQKGHS HIAVVYKDLDEQEQSPETSENGIERRKNKKTKDELFKDSCRKPKAQFEVSEKEVFKIETG DAKSGKSENGEEQQGSGKTSLLAAPAKKRHRGCSFCILDIENTPIPDFPTNEEVVGVITM EDVIEELLQEEILDETDEYVNIHNRIRVNMHASPENLPSVITSITQSSSGSTSPNQTSHM ATPDSSPTTKPSNSSPTRKPSVSSPTREPSDSSHSMAPKHEESTQTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CBSDUF7 |
Synonyms | CBSDUF7; At1g47330; T3F24.6; DUF21 domain-containing protein At1g47330; CBS domain-containing protein CBSDUF7 |
UniProt ID | Q8RY60 |
◆ Recombinant Proteins | ||
TAS2R7-4626R | Recombinant Rhesus monkey TAS2R7 Protein, His-tagged | +Inquiry |
GBE1-3494M | Recombinant Mouse GBE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ISG20-508H | Recombinant Human ISG20 protein, GST-tagged | +Inquiry |
RRAGA-14515M | Recombinant Mouse RRAGA Protein | +Inquiry |
GIMAP4-5257HF | Recombinant Full Length Human GIMAP4 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
AK1-6667C | Active Native Chicken AK1 | +Inquiry |
Tenascin-112H | Native Human Tenascin | +Inquiry |
BCHE-5291H | Native Human Butyrylcholinesterase | +Inquiry |
MFGE8-289B | Native MFG-E8 | +Inquiry |
HA-007R | Native Rooster comb Hyaluronic acid sodium salt | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR1-1972RCL | Recombinant Rat FCGR1 cell lysate | +Inquiry |
FUT8-497HCL | Recombinant Human FUT8 cell lysate | +Inquiry |
TLR3-642MCL | Recombinant Mouse TLR3 cell lysate | +Inquiry |
EEF1A2-242HCL | Recombinant Human EEF1A2 lysate | +Inquiry |
CD80-2715HCL | Recombinant Human CD80 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CBSDUF7 Products
Required fields are marked with *
My Review for All CBSDUF7 Products
Required fields are marked with *
0
Inquiry Basket